Recombinant Saccharomyces cerevisiae Cell wall integrity and stress response component 4 (WSC4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance (incurring additional charges).
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If a specific tag is required, please inform us, and we will prioritize its inclusion.
Synonyms
WSC4; YHL028W; Cell wall integrity and stress response component 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
27-605
Protein Length
Full Length of Mature Protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
WSC4
Target Protein Sequence
TQSVCSSQNTATTDGVRNQFQSNGWCSNNCAGHQFAIVQGFMCWCSDSEPSTQTSVGDCS GTCPGYGYEDCGNADKDLFGYIYLGQTPLSSVQSVETSTESSVYVSSSSITSSSSTSIVD TTTISPTLTSTSTTPLTTASTSTTPSTDITSALPTTTSTKLSTSIPTSTTSSTSTTTSTS SSTSTTVSVTSSTSTTTSTTSSTLISTSTSSSSSSTPTTTSSAPISTSTTSSTSTSTSTT SPTSSSAPTSSSNTTPTSTTFTTTSPSTAPSSTTVTYTSTTASPITSTITSVNLQTSLKY SVITVTSVHTMDTNISEITSRYLTMKKVITQIYSSTLGATPTSAVATTSASVGGRITNNN NSNTTNSNTPTNKSTEKKGYWDSPGKIAATFVVVGVVCLVIICILIYLIHHYRTRPARKA QDFENEYQSKFYQSKYPNEVTTTTLHTPSPSSNSTFSTPRLIYTDEKGQIMSESPSPRQS TYSLTAGSPPNDPSTLASPFHDPILPRRTSTFLHSPIQKQHEKMESNVTLGEDTVLVDQR LDPSKMLNTLANDDATNHSTISLSDNVDYSRRVLRLMNE
Uniprot No.

Target Background

Database Links

KEGG: sce:YHL028W

STRING: 4932.YHL028W

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is WSC4 and how does it function in Saccharomyces cerevisiae?

WSC4 (YHL028W, also known as YFW1 or YHC8) is an endoplasmic reticulum (ER) membrane protein in Saccharomyces cerevisiae that serves dual functions. Primarily, it is involved in the translocation of soluble secretory proteins and insertion of membrane proteins into the ER membrane. Additionally, WSC4 plays a role in the cellular stress response, though with only partial functional overlap with other WSC family members (WSC1-3) . Unlike other WSC proteins that are primarily involved in cell wall integrity maintenance, WSC4's distinct function suggests evolutionary specialization within this protein family .

How does WSC4 differ structurally and functionally from other WSC family proteins?

WSC4 differs from other WSC family members in several important ways:

FeatureWSC1-3WSC4
Primary locationCell wall/membraneEndoplasmic reticulum membrane
Primary functionCell wall integrity sensorsProtein translocation/membrane insertion
Stress response roleMajorPartial/Supportive
Effect of deletionSevere cell lysis defectsMinimal direct cell wall defects
Interaction with PKC1 pathwayDirect activationIndirect/secondary role

What cellular pathways involve WSC4 protein?

WSC4 is involved in multiple cellular pathways:

  • Protein translocation pathway: Functions in the movement of soluble secretory proteins across the ER membrane .

  • Membrane protein insertion pathway: Facilitates the integration of membrane proteins into the ER membrane .

  • Stress response pathways: Particularly in response to heat shock, ethanol exposure, and DNA-damaging conditions .

  • Cell wall integrity pathway: Has partial involvement, primarily through its interaction with the broader stress response network .

Recent research suggests WSC4 may also interface with TORC1 signaling branches that regulate proteasome activity, though this relationship requires further characterization .

What are the most effective methods for generating recombinant S. cerevisiae strains expressing modified WSC4?

When designing experiments to generate recombinant S. cerevisiae strains with modified WSC4, researchers should consider:

Recommended approach:

  • Gene targeting strategy: Use homologous recombination-based methods for precise modification of the WSC4 locus.

  • Expression system selection: For functional studies, maintain expression under the native promoter. For overexpression studies, use inducible promoters like GAL1.

  • Epitope tagging considerations: C-terminal tagging is preferable as N-terminal modifications may disrupt ER targeting sequences.

  • Verification protocols: Confirm modifications through both PCR-based genotyping and Western blot analysis.

Experimental design considerations:

  • Include appropriate controls, particularly WSC1-3 deletion strains for comparative analysis

  • Design experiments with both single and combination deletions to assess functional redundancy

  • Consider the impact of strain background on WSC4 function; laboratory strains like S288c are standard but clinical isolates may provide different insights

  • Include proper verification of cellular localization through fluorescence microscopy

How can researchers effectively measure cell wall integrity in WSC4 mutants?

To effectively assess cell wall integrity in WSC4 mutants, researchers should employ multiple complementary approaches:

  • Sensitivity assays to cell wall stressors:

    • Heat shock (37-39°C)

    • Cell wall-perturbing agents (Calcofluor White, Congo Red)

    • Osmoregulatory challenges (high/low osmolarity shifts)

    • Ethanol exposure (6-10%)

    • Hydrogen peroxide treatment (0.5-3 mM)

  • Cell wall composition analysis:

    • Quantification of β-1,3-glucan and chitin content

    • Assessment of mannoproteins via quantitative proteomics

    • Analysis of cell wall protein linkages (GPI-anchored vs. PIR proteins)

  • Functional assays:

    • Cell lysis rates under stress conditions

    • Zymolyase sensitivity testing

    • Measurement of cell wall porosity

  • Molecular indicators:

    • Activation of the cell wall integrity pathway (Mpk1/Slt2 phosphorylation)

    • Expression of cell wall stress-responsive genes

    • Rlm1-dependent transcriptional reporter assays

The experimental design should include appropriate controls (wild-type, wsc1Δ, and combined wsc mutants) and time-course measurements to capture both immediate and adaptive responses.

What experimental approaches are recommended for studying WSC4's dual roles in protein translocation and stress response?

To dissect WSC4's dual functionality, researchers should design experiments that can distinguish between its ER functions and stress response roles:

Protein translocation studies:

  • In vitro translocation assays using microsomes derived from WSC4 mutants

  • Pulse-chase experiments tracking secretory protein movement

  • Visualization of protein trafficking using fluorescently tagged cargo proteins

  • Measurement of UPR (unfolded protein response) activation in WSC4 mutants

Stress response studies:

  • Transcriptional profiling under various stress conditions

  • Epistasis analysis with cell wall integrity pathway components

  • Stress survival assays comparing WSC4 mutants with other WSC family mutants

  • Analysis of WSC4 phosphorylation and other post-translational modifications during stress

Integrated approaches:

  • Proteomic analysis of the WSC4 interactome under normal and stress conditions

  • Structure-function analysis using domain-specific WSC4 mutants

  • Conditional expression systems to temporally separate roles

  • Suppressor screens to identify genetic interactions

When designing these experiments, it's critical to establish proper controls and consider the temporal dynamics of both protein translocation processes and stress responses .

How should researchers interpret apparent contradictions in WSC4 functional data?

When faced with contradictory data regarding WSC4 function, researchers should follow this systematic approach:

  • Evaluate experimental contexts:

    • Compare strain backgrounds (laboratory vs. clinical isolates)

    • Assess growth conditions and media compositions

    • Consider the specific stressors and their concentrations

    • Examine the timing of measurements (acute vs. chronic responses)

  • Analyze genetic interactions:

    • WSC4 may have compensatory relationships with other genes

    • Different phenotypes might emerge in single vs. multiple deletion backgrounds

    • The fitness cost of WSC4 deletion may be condition-dependent

  • Consider post-translational regulation:

    • WSC4's function may be modified by phosphorylation or other modifications

    • Protein stability and localization could vary across experimental conditions

  • Apply statistical rigor:

    • Ensure sufficient biological and technical replicates

    • Use appropriate statistical tests for the data distribution patterns

    • Consider employing multivariate analysis to identify complex relationships

Remember that apparent contradictions often reflect the biological complexity of WSC4's dual roles in protein translocation and stress response. The protein may prioritize different functions depending on cellular context and environmental conditions .

What methodologies are most appropriate for analyzing WSC4 protein interactions and modification sites?

For comprehensive analysis of WSC4 protein interactions and modifications, researchers should employ:

Protein interaction methodologies:

  • Affinity purification coupled with mass spectrometry (AP-MS)

  • Yeast two-hybrid screening with appropriate controls

  • Bimolecular fluorescence complementation (BiFC) for in vivo validation

  • Proximity-dependent biotin identification (BioID) to capture transient interactions

Post-translational modification analysis:

  • Phosphoproteomics using TiO₂ enrichment or IMAC (immobilized metal affinity chromatography)

  • Site-directed mutagenesis of potential modification sites

  • Western blotting with modification-specific antibodies

  • Mass spectrometry with electron transfer dissociation (ETD) for precise site mapping

The BioGRID database currently lists 37 interactors and 44 interactions for WSC4, with 6 documented post-translational modification sites . These represent valuable starting points for targeted validation studies.

When interpreting interaction data, researchers should be particularly attentive to differences between constitutive interactions (likely related to ER functions) and stress-induced interactions (potentially connected to cell wall integrity pathways).

How does WSC4 function differ between laboratory and clinical isolates of S. cerevisiae?

Recent research has revealed important differences in WSC4 expression and function between laboratory strains and clinical isolates of S. cerevisiae:

Key differences observed:

ParameterLaboratory Strains (e.g., S288c)Clinical Isolates
Cell surface hydrophobicityRelatively hydrophilicMore hydrophobic
Cell wall protein abundanceBaseline levelsHigher abundance of specific CWPs
WSC4 expression patternsConstitutive, low-levelOften upregulated during stress
Stress response timingSlower activationFaster activation
Virulence potentialLimitedEnhanced

Experimental approaches to study these differences should include:

  • Comparative transcriptomics and proteomics across multiple strains

  • Heterologous expression of clinical WSC4 variants in laboratory strains

  • Virulence assays in appropriate model systems

  • Analysis of cell wall composition and integrity under various stress conditions

What is the relationship between WSC4 and the TORC1 signaling pathway in stress response?

Recent research indicates complex interactions between WSC4 and the TORC1 signaling pathway:

  • TORC1 inhibition effects:

    • TORC1 inhibition alters cell wall properties

    • These changes activate the cell wall integrity pathway through Wsc1, Wsc3, and potentially WSC4

    • The activation appears to be mediated through distinct TORC1 signaling branches

  • Proteasome regulation:

    • WSC4 may be involved in TORC1-dependent regulation of proteasome activity

    • This represents a novel connection between cellular stress sensing and protein degradation pathways

  • Signal integration:

    • WSC4 potentially functions as part of a sensing mechanism that integrates information about:

      • Nutrient availability (via TORC1)

      • Cell wall/membrane integrity

      • Protein homeostasis

This emerging area requires further investigation, particularly regarding the specific molecular mechanisms by which WSC4 interfaces with TORC1 signaling components and how this relationship influences cell survival under various stress conditions .

How can researchers effectively study WSC4's role in fungal pathogenicity?

To investigate WSC4's potential contributions to fungal pathogenicity, researchers should employ:

  • Comparative genomics and proteomics:

    • Analyze WSC4 sequence and expression differences between non-pathogenic and clinical isolates

    • Identify potential virulence-associated modifications or variants

    • Compare WSC4 with homologs in pathogenic fungi like Candida species

  • Host-pathogen interaction models:

    • Develop appropriate cell culture systems (e.g., macrophage interaction assays)

    • Utilize relevant animal models for virulence assessment

    • Measure adherence to biotic and abiotic surfaces

  • Immune response characterization:

    • Analyze host immune recognition of WSC4 or WSC4-dependent cell wall components

    • Study inflammatory responses triggered by different WSC4 variants

    • Investigate WSC4's role in immune evasion strategies

  • Therapeutic target assessment:

    • Evaluate WSC4 as a potential antifungal target

    • Screen for compounds that specifically disrupt WSC4 function

    • Assess synergistic effects with existing antifungals

The quantitative cell wall subproteome approach used by Hsu et al. represents a valuable methodology for such studies, as they successfully identified several cell wall proteins (including Hsp150p in the Pir family) that were expressed at higher levels in clinical isolates and potentially contribute to virulence .

What are the optimal methods for measuring WSC4 expression and localization?

For accurate assessment of WSC4 expression and localization, researchers should consider:

Expression analysis methods:

  • Quantitative RT-PCR:

    • Most sensitive for transcript-level quantification

    • Requires careful primer design to avoid cross-amplification of other WSC genes

    • Essential to use appropriate reference genes for normalization

  • Western blotting:

    • Preferable with epitope-tagged WSC4 due to limited antibody availability

    • Requires careful membrane protein extraction protocols

    • Should include appropriate loading controls for ER membrane proteins

  • Mass spectrometry:

    • Liquid chromatography/tandem mass spectrometry provides quantitative protein data

    • Enables simultaneous analysis of multiple cell wall proteins

    • Requires specialized sample preparation for membrane proteins

Localization methods:

  • Fluorescence microscopy:

    • C-terminal fluorescent protein tagging (e.g., GFP, mCherry)

    • Immunofluorescence with appropriate fixation protocols for ER proteins

    • Co-localization with established ER markers

  • Subcellular fractionation:

    • Differential centrifugation to isolate ER membranes

    • Sucrose gradient separation for membrane protein enrichment

    • Western blot analysis of fractions with ER markers as controls

  • Proximity labeling:

    • APEX2 or BioID fusion proteins for spatial proteomics

    • Allows identification of proximal proteins in living cells

    • Provides contextual information about WSC4's microenvironment

When implementing these methods, researchers should be mindful of WSC4's dual localization patterns under different conditions and ensure appropriate controls for distinguishing between ER membrane and potential cell wall/plasma membrane populations.

What experimental design principles should be followed when studying WSC4 in stress response?

When designing experiments to study WSC4's role in stress response, researchers should adhere to these key principles:

  • Control selection and experimental variables:

    • Include appropriate positive controls (known stress-sensitive mutants)

    • Use multiple negative controls (wild-type and complemented strains)

    • Test multiple stressors at physiologically relevant concentrations

    • Include time-course measurements to capture adaptive responses

  • Stress application considerations:

    • Standardize the method of stress application

    • Consider acute vs. chronic stress exposure

    • Account for potential cross-adaptation between stressors

    • Monitor cellular viability throughout the experiment

  • Readout selection:

    • Employ both growth-based phenotypic assays and molecular indicators

    • Include markers for cell wall integrity pathway activation

    • Measure cell wall compositional changes

    • Monitor expression of stress-responsive genes

  • Data analysis approaches:

    • Apply appropriate statistical methods for time-series data

    • Consider using area under the curve analyses for growth assays

    • Implement multivariate analysis for complex phenotypes

    • Ensure sufficient biological and technical replication (minimum n=3)

  • Validation strategies:

    • Confirm key findings with complementary methodologies

    • Test findings across multiple strain backgrounds

    • Use genetic rescue experiments to verify causality

    • Consider dose-response relationships to establish specificity

Following these experimental design principles will help ensure reproducible and physiologically relevant results when studying WSC4's complex roles in stress response .

How can researchers effectively use gene editing techniques to study WSC4 function?

For precise genetic manipulation of WSC4, researchers should consider these approaches:

CRISPR-Cas9 protocols for WSC4 modification:

  • Guide RNA design considerations:

    • Target unique sequences to avoid off-target effects on other WSC genes

    • Design multiple gRNAs to increase editing efficiency

    • Consider the impact of chromatin structure on accessibility

  • Repair template design:

    • For point mutations, use short single-stranded oligonucleotides

    • For insertions (tags, reporters), use longer double-stranded DNA with extensive homology arms

    • Include silent mutations in the PAM site to prevent re-cutting

  • Delivery methods:

    • Plasmid-based expression of Cas9 and gRNA

    • Ribonucleoprotein (RNP) complex transformation for transient expression

    • Integration of Cas9 under inducible promoter for temporal control

  • Verification strategies:

    • Sequence verification of the target locus

    • Functional validation through phenotypic assays

    • Expression analysis to confirm expected transcript/protein levels

    • Localization studies to verify proper targeting

Specific applications for WSC4 research:

  • Domain-specific mutations to dissect function

  • Fluorescent protein fusions for live-cell imaging

  • Degron tagging for conditional protein depletion

  • Promoter replacement for expression modulation

When implementing these techniques, researchers should be mindful of potential compensatory mechanisms within the WSC family and consider creating double or triple mutants to fully reveal functional relationships .

What are the major unresolved questions about WSC4 function?

Despite significant advances in understanding WSC4, several critical questions remain unresolved:

  • Molecular mechanism questions:

    • How does WSC4 specifically contribute to protein translocation?

    • What is the structural basis for WSC4's stress-sensing capability?

    • How does WSC4 communicate with signaling pathways during stress?

    • What post-translational modifications regulate WSC4 activity?

  • Functional integration questions:

    • How are WSC4's dual roles in ER function and stress response coordinated?

    • What mechanisms determine WSC4's functional prioritization under different conditions?

    • How does WSC4 interact with other WSC family members at the molecular level?

    • What is the evolutionary significance of WSC4's functional divergence?

  • Pathobiology questions:

    • How does WSC4 contribute to S. cerevisiae virulence in opportunistic infections?

    • Could WSC4 or its downstream pathways serve as potential therapeutic targets?

    • How do clinical isolates optimize WSC4 function compared to laboratory strains?

    • What role does WSC4 play in biofilm formation and other virulence-associated behaviors?

Addressing these questions will require innovative approaches combining structural biology, advanced imaging, genetic manipulation, and systems biology methodologies.

What novel methodologies might advance our understanding of WSC4 function?

Emerging technologies with potential to significantly advance WSC4 research include:

  • Cryo-electron microscopy:

    • Determine high-resolution structures of WSC4 in different functional states

    • Visualize interaction complexes with translocation machinery

    • Map conformational changes during stress sensing

  • Single-cell approaches:

    • Single-cell RNA-seq to capture heterogeneity in WSC4 responses

    • Live-cell imaging with advanced biosensors for real-time activity monitoring

    • Microfluidics platforms for controlled stress application and monitoring

  • Integrative multi-omics:

    • Combined transcriptomics, proteomics, and metabolomics to map WSC4-dependent networks

    • Spatial proteomics to precisely map WSC4's changing interactions during stress

    • Systems biology modeling of WSC4's role in cellular homeostasis

  • Advanced genetic tools:

    • Base editing for precise single nucleotide modifications

    • Optogenetic control of WSC4 activity

    • Synthetic genetic array analysis for comprehensive genetic interaction mapping

These methodologies would provide unprecedented insight into WSC4's molecular functions and its integration within broader cellular networks governing stress response and ER function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.