Recombinant Saccharomyces cerevisiae Choline/ethanolaminephosphotransferase 1 (EPT1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant EPT1

EPT1 (UniProt ID: P22140) is a membrane-bound enzyme encoded by the EPT1 gene in S. cerevisiae. Recombinant EPT1 is expressed in systems like E. coli or mammalian cells, often fused with affinity tags (e.g., His-tag) for purification . It plays a dual role in phospholipid metabolism:

  • Catalyzes the transfer of phosphocholine or phosphoethanolamine from CDP-choline/CDP-ethanolamine to diacylglycerol (DAG), forming PC or PE .

  • Accounts for 5% of PC synthesis in vivo, with the majority mediated by CPT1 .

Primary Structure

  • Length: 391 amino acids .

  • Sequence: Contains critical domains for CDP-amino alcohol binding and DAG acyl chain specificity .

PropertyDetails
Molecular Weight~45 kDa (calculated)
Transmembrane DomainsMultiple domains, including three predicted segments critical for DAG specificity
Active SitesCDP-amino alcohol binding region (residues 1–218)

Post-Translational Modifications

  • Requires phospholipid cofactors (e.g., phosphatidylcholine) for activation .

Substrates and Reactions

ReactionCatalytic Activity
CDP-choline + 1,2-diacylglycerol → CMP + phosphatidylcholine KmK_m (CDP-choline) = 0.5–1.0 mM
CDP-ethanolamine + 1,2-diacylglycerol → CMP + phosphatidylethanolamine KmK_m (CDP-ethanolamine) = 0.2–0.5 mM

Cofactors and Regulation

  • Cations: Activated by Mg²⁺, Mn²⁺, or Co²⁺, with Mg²⁺ being physiologically relevant .

  • Phospholipids: Phosphatidylcholine activates EPT1, enabling product feedback regulation .

Recombinant Expression Systems

Host SystemTagPurityApplication
E. coli His>90%Enzyme kinetics, structural studies
Mammalian Cells His/Fc>95%Drug discovery, functional assays
Baculovirus None>85%Large-scale production

Kinetic Parameters

ParameterValueCondition
Optimal pH7.5–8.5 Tris/PBS buffer
VmaxV_{max} (PC)120 nmol/min/mg 30°C, Mg²⁺ activation
VmaxV_{max} (PE)80 nmol/min/mg 30°C, Mg²⁺ activation

Lipid Activation Profiles

  • Most Effective Activators: Phosphatidylcholine > sphingomyelin > phosphatidylethanolamine .

  • Ineffective Lipids: Phosphatidylserine, phosphatidylinositol .

Phospholipid Metabolism Studies

  • EPT1-deficient yeast strains show resistance to choline analogs (e.g., G25), linking its activity to membrane integrity .

  • Chimeric CPT1/EPT1 enzymes identified residues governing substrate specificity and regulatory roles in phospholipid synthesis .

Drug Discovery

  • EPT1 is a potential target for antimalarial drugs, as its homolog in Plasmodium falciparum is inhibited by choline analogs .

Key Research Findings

  1. Substrate Specificity:

    • EPT1’s CDP-amino alcohol binding domain (residues 1–218) determines its dual choline/ethanolamine specificity .

    • DAG acyl chain preference is governed by a 218-amino-acid region containing transmembrane domains .

  2. Regulatory Role:

    • EPT1 activity is essential for coordinating choline uptake with PC biosynthesis, as shown by feedback regulation in cpt1Δ mutants .

  3. Cation Dependence:

    • Mg²⁺ activation occurs via direct binding to EPT1, not through substrate complexation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by factors including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing it.
Synonyms
EPT1; YHR123W; Choline/ethanolaminephosphotransferase 1; ETHPT; Ethanolaminephosphotransferase 1; Aminoalcohol phosphotransferase EPT1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-391
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
EPT1
Target Protein Sequence
MGYFVPDSHIENLKSYKYQSEDRSLVSKYFLKPFWQRFCHIFPTWMAPNIITLSGFAFIV INVLTVFYYDPNLNTDTPRWTYFSYALGVFLYQTFDGCDGVHARRINQSGPLGELFDHSI DAINSTLSIFIFASETGMGFSYNLMLSQFAMLTNFYLSTWEEYHTHTLYLSEFSGPVEGI LIVCVSLILTGIYGKQVIWHTYLFTITVGDKVIDVDTLDIVFSLAVFGLVMNALSAKRNV DKYYRNSTSSANNITQIEQDSAIKGLLPFFAYYASIALLVWMQPSFITLSFILSVGFTGA FTVGRIIVCHLTKQSFPMFNAPMLIPLCQIVLYKICLSLWGIESNKIVFALSWLGFGLSL GVHIMFMNDIIHEFTEYLDVYALSIKRSKLT
Uniprot No.

Target Background

Function
This enzyme catalyzes the final step in the CDP-ethanolamine pathway, leading to the production of phosphatidylethanolamine (PE). It can also catalyze the formation of phosphatidylcholine (PC) from CDP-choline, but it does not significantly contribute to PC biosynthesis. EPT1 preferentially utilizes CDP-dimethylethanolamine and CDP-propanolamine as aminoalcohol substrates. It exhibits the highest activity toward di-unsaturated diacylglycerol species as lipid substrates. The CDP-ethanolamine pathway may play a crucial role in maintaining the appropriate distribution of PE species.
Database Links

KEGG: sce:YHR123W

STRING: 4932.YHR123W

Protein Families
CDP-alcohol phosphatidyltransferase class-I family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the function of EPT1 in Saccharomyces cerevisiae?

EPT1 in Saccharomyces cerevisiae encodes a choline/ethanolaminephosphotransferase that catalyzes the final step in phospholipid biosynthesis. The EPT1 gene product possesses dual functionality, exhibiting both ethanolamine- and cholinephosphotransferase activities. In phospholipid synthesis, it transfers phosphoethanolamine from CDP-ethanolamine to diacylglycerol to form phosphatidylethanolamine (PtdEtn), and to a lesser extent, transfers phosphocholine from CDP-choline to diacylglycerol to form phosphatidylcholine (PC) . While in vitro studies demonstrate that EPT1 accounts for approximately 50% of measurable choline-phosphotransferase activity, in vivo research reveals it contributes only about 5% of PC synthesis via the CDP-choline pathway, with the CPT1 gene product being responsible for the remaining 95% .

Is EPT1 essential for yeast cell viability?

EPT1 is not essential for growth in Saccharomyces cerevisiae. Genetic analysis has confirmed that yeast can survive with deletional EPT1 mutations. Research with ept1 null mutants has demonstrated that while these mutants show significantly reduced ethanolaminephosphotransferase activity (30-90 fold reduction compared to wild-type), the cells remain viable . This non-essentiality makes EPT1 an excellent candidate for recombinant expression studies, as researchers can work with EPT1-deficient strains without compromising basic cell functions, allowing for cleaner experimental backgrounds when introducing recombinant or modified versions of the protein.

What expression systems are optimal for recombinant EPT1 production?

For recombinant EPT1 production, Saccharomyces cerevisiae strains lacking endogenous cholinephosphotransferase or ethanolaminephosphotransferase activities (such as strain HJ091, cpt1::LEU2 ept1) serve as optimal expression hosts. This approach eliminates interference from native phosphotransferase activities during functional characterization . The expression vector should contain appropriate yeast promoters and selection markers. For purification purposes, adding affinity tags such as a His-tag to the recombinant protein facilitates isolation through affinity chromatography .

Expression protocols typically involve transforming the expression vector into the yeast host using standard transformation protocols, followed by selection on appropriate media, and induction of protein expression. The membrane-associated nature of EPT1 (containing multiple transmembrane domains) requires careful consideration during solubilization and purification steps, often necessitating detergent-based extraction methods.

How can I verify the activity of recombinant EPT1 after purification?

To verify recombinant EPT1 activity after purification, conduct enzymatic assays measuring both ethanolaminephosphotransferase and cholinephosphotransferase activities. A standard assay involves:

  • Prepare reaction mixture containing:

    • Purified recombinant EPT1

    • Diacylglycerol substrate

    • CDP-ethanolamine or CDP-choline (radiolabeled for quantification)

    • Appropriate buffer system with optimal pH (typically pH 7.5)

    • Cofactors including Mg²⁺

  • Incubate the reaction mixture at optimal temperature (30°C for yeast-derived enzyme)

  • Extract and quantify the phospholipid products (phosphatidylethanolamine or phosphatidylcholine) using:

    • Organic solvent extraction

    • Thin-layer chromatography separation

    • Scintillation counting for radiolabeled products

Activity verification should include comparison to established standards, examination of substrate specificity with various diacylglycerol species, and determination of kinetic parameters. In functional complementation studies, recombinant EPT1 should restore phospholipid synthesis when expressed in EPT1-deficient yeast strains, with restored synthesis measurable through radiolabeled precursor incorporation assays .

How does EPT1 contribute to phospholipid homeostasis in relation to CPT1?

EPT1 plays a complementary but distinct role to CPT1 in phospholipid homeostasis. While both enzymes can catalyze cholinephosphotransferase reactions in vitro, they demonstrate different in vivo preferences and activities:

ParameterEPT1CPT1
In vitro choline-phosphotransferase activity~50% of total~50% of total
In vivo contribution to PC synthesis~5%~95%
CDP-aminoalcohol specificityBroad (CDP-choline and CDP-ethanolamine)Narrow (primarily CDP-choline)
CMP sensitivity of residual activityCMP-insensitiveCMP-sensitive
Primary in vivo functionEthanolaminephosphotransferaseCholinephosphotransferase
Role in inositol-mediated regulationLimited roleRequired for pleiotropic regulation of phospholipid synthesis by inositol

What structural elements determine substrate specificity in EPT1?

The substrate specificity of EPT1 is determined by specific structural domains within the protein. Experimental evidence from chimeric CPT1/EPT1 enzymes has mapped the critical regions that confer CDP-aminoalcohol specificity.

The EPT1 protein contains the conserved CDP-alcohol phosphotransferase motif, DG(X)2AR(X)8G(X)3D(X)3D, which is essential for catalytic activity. This motif is positioned within an amphipathic helix in the active site of the enzyme . Structure-function studies using chimeric enzymes have demonstrated that the CDP-aminoalcohol binding domain is particularly important for determining whether the enzyme preferentially utilizes CDP-ethanolamine or CDP-choline.

In human CEPT1 (which has functional similarities to yeast EPT1), seven membrane-spanning domains have been identified, with the protein having a molecular mass of approximately 46.5 kDa . The transmembrane topology is critical for positioning the active site appropriately within the membrane environment where the enzyme accesses its lipid substrates.

What are the optimal conditions for measuring EPT1 enzymatic activity in vitro?

The optimal conditions for measuring EPT1 enzymatic activity in vitro require careful consideration of multiple parameters:

  • Buffer composition:

    • Tris-HCl buffer (50 mM, pH 7.5-8.0)

    • MgCl₂ (10-15 mM) as a cofactor

    • Reducing agent (1-5 mM DTT) to maintain protein stability

  • Substrate preparation:

    • Diacylglycerol presented in mixed micelles with Triton X-100

    • CDP-ethanolamine or CDP-choline (typically 0.1-0.5 mM)

    • For detection, [¹⁴C]-labeled or [³H]-labeled CDP-aminoalcohols

  • Reaction conditions:

    • Temperature: 30°C (optimal for yeast-derived enzyme)

    • pH: 7.5-8.0

    • Incubation time: 15-30 minutes (must be in linear range)

    • Protein concentration: 10-50 μg membrane protein per assay

  • Product analysis:

    • Lipid extraction using Bligh-Dyer method

    • Separation by thin-layer chromatography

    • Quantification by scintillation counting or phosphorimaging

When comparing wild-type and mutant EPT1 activities, identical reaction conditions must be maintained. Additionally, kinetic parameters should be determined through Lineweaver-Burk or Eadie-Hofstee analyses by varying substrate concentrations while keeping other factors constant .

How can I generate and characterize EPT1 knockout models for functional studies?

Generating and characterizing EPT1 knockout models involves several methodological approaches:

  • CRISPR/Cas9-mediated gene disruption:

    • Design guide RNAs targeting exon 1 or other critical regions of EPT1

    • For example, guide RNA sequences such as 5′-caccgAGTTTTCGGGTCGTCATGGC-3′ (sense) and 5′-aaacGCCATGACGACCCGAAAACTc-3′ (antisense) can be cloned into appropriate vectors like pSpCas9(BB)-2A-Puro

    • Transfect cells with the vector using standard transfection protocols

    • Select transformants using appropriate antibiotics (e.g., puromycin at 2 μg/ml)

    • Isolate single clones and expand for screening

  • Verification of gene disruption:

    • PCR amplification and sequencing of the targeted locus

    • RT-PCR to confirm absence of wild-type transcript

    • Western blotting if antibodies are available

    • Enzymatic activity assays to confirm loss of EPT1 function

  • Phenotypic characterization:

    • Phospholipid profiling using mass spectrometry

    • Growth rate analysis under various conditions

    • Membrane integrity assessments

    • Complementation tests with wild-type EPT1 to confirm phenotype specificity

  • Functional rescue experiments:

    • Clone wild-type EPT1 into expression vectors

    • Generate EPT1 variants with specific mutations

    • Transform knockout cells with these constructs

    • Measure restoration of enzymatic activity and phospholipid synthesis

In yeast specifically, the EPT1 gene can be disrupted by homologous recombination using a deletion cassette containing a selectable marker (like LEU2) flanked by sequences homologous to the regions surrounding the EPT1 open reading frame . The resulting ept1 deletion strains should be verified by PCR and functional assays.

How can EPT1 structure-function relationships be leveraged for biotechnological applications?

EPT1's structure-function relationships offer several promising biotechnological applications:

  • Engineered phospholipid production systems:

    • Modified EPT1 enzymes with altered substrate specificity can be designed to produce novel phospholipids with specific fatty acid compositions

    • These custom phospholipids have potential applications in drug delivery systems, liposome formulation, and membrane protein research

  • Biosensors for lipid metabolism:

    • EPT1 can be engineered as part of FRET-based biosensor systems to monitor phospholipid metabolism in real-time

    • Such biosensors could detect changes in cellular lipid homeostasis in response to various stimuli

  • Metabolic engineering for industrial applications:

    • Understanding the regulatory mechanisms of EPT1 enables optimization of phospholipid production in yeast

    • This knowledge can be applied to enhance production of high-value phospholipids or improve yeast strain performance in industrial fermentations

The CDP-aminoalcohol binding domain of EPT1 is particularly important for these applications, as it determines substrate specificity. Chimeric enzymes combining this domain from various sources have demonstrated altered activity profiles, suggesting that rational design approaches can yield enzymes with novel properties .

What insights can comparative studies between yeast and human phosphotransferases provide?

Comparative studies between yeast EPT1 and human phosphotransferases (like hCEPT1) offer valuable insights into phospholipid metabolism evolution and disease mechanisms:

  • Evolutionary conservation:

    • Human CEPT1 functions similarly to yeast EPT1 with broad substrate specificity

    • Human CEPT1 efficiently complements yeast strains lacking both CPT1 and EPT1 functions

    • The conserved CDP-alcohol phosphotransferase motif (DG(X)2AR(X)8G(X)3D(X)3D) is present in both proteins

  • Disease-relevant insights:

    • Mutations in human EPT1 have been linked to hereditary spastic paraplegia (HSP)

    • Yeast models expressing these mutations can help elucidate the molecular basis of disease

  • Structural insights:

    • Human CEPT1 contains seven membrane-spanning domains

    • The predicted amphipathic helix containing catalytic residues is structurally conserved

    • These structural features provide templates for designing inhibitors or modulators

  • Therapeutic target potential:

    • Understanding differences between yeast and human enzymes facilitates development of selective inhibitors

    • Such inhibitors could have applications in treating diseases with dysregulated phospholipid metabolism

A heterologous expression system using yeast strains lacking endogenous phosphotransferase activities (cpt1::LEU2 ept1) provides an excellent platform for studying human CEPT1 variants in a clean cellular background, enabling both in vitro and in vivo assessment of activity .

How can I address low expression yields of recombinant EPT1?

When facing low expression yields of recombinant EPT1, implement these methodological solutions:

  • Expression vector optimization:

    • Use stronger promoters specific for membrane proteins (such as GAL1 for inducible expression)

    • Optimize codon usage for the host organism

    • Include appropriate secretion signals or membrane-targeting sequences

    • Add stabilizing fusion partners that enhance folding

  • Host strain engineering:

    • Select strains with reduced proteolytic activity (e.g., protease-deficient strains)

    • Use hosts optimized for membrane protein expression

    • Consider temperature-sensitive variants for proteins that may be toxic when overexpressed

  • Culture condition optimization:

    • Decrease culture temperature (20-25°C) during induction to slow protein production and improve folding

    • Add chemical chaperones (such as glycerol or DMSO) to stabilize membrane proteins

    • Implement fed-batch cultivation to maintain optimal growth conditions

    • Adjust induction timing to correspond with appropriate growth phase

  • Purification protocol modifications:

    • Implement gentle solubilization using appropriate detergents (DDM, CHAPS, or digitonin)

    • Include stabilizing lipids during extraction and purification

    • Use affinity tags positioned to minimize interference with membrane integration

    • Incorporate quality control steps to identify and isolate properly folded protein

These approaches should be tested systematically, measuring protein expression levels through activity assays and Western blotting at each optimization step .

What are the potential pitfalls in interpreting EPT1 functional data?

Researchers should be aware of several potential pitfalls when interpreting EPT1 functional data:

  • Overlapping enzyme activities:

    • EPT1 and CPT1 have partially overlapping substrate specificities

    • In vitro, EPT1 accounts for approximately 50% of measurable cholinephosphotransferase activity, but contributes only about 5% to PC synthesis in vivo

    • Always validate in vitro findings with in vivo experiments to account for this discrepancy

  • Regulatory effects:

    • EPT1 activity is influenced by inositol levels and other regulatory mechanisms

    • The CPT1 gene product, not EPT1, is primarily responsible for the pleiotropic regulation of phospholipid synthesis by inositol

    • Consider the broader regulatory context when interpreting isolated enzyme activity data

  • Species-specific differences:

    • While yeast EPT1 and human CEPT1 share functional similarities, they may respond differently to regulatory signals

    • Data from yeast systems may not directly translate to mammalian contexts without validation

  • Technical considerations:

    • The membrane-associated nature of EPT1 makes activity measurements highly dependent on preparation methods

    • Different detergents can significantly affect measured activity

    • Substrate presentation (micelles, liposomes, or natural membranes) influences enzyme kinetics

    • Always include appropriate controls and standardized conditions when comparing different experimental setups

To address these challenges, researchers should implement comprehensive experimental designs that include both in vitro and in vivo assays, multiple substrate types, and appropriate genetic controls (such as complementation studies in knockout strains) .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.