Recombinant Saccharomyces cerevisiae Cholinephosphotransferase 1 (CPT1)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Structure

  • Gene Locus: YNL130C (chromosome XIV) .

  • Protein Length: 407 amino acids (predicted molecular weight: 46.3 kDa) .

  • Domains: Contains seven transmembrane helices and a CDP-alcohol phosphotransferase domain .

  • Catalytic Activity:

    CDP-choline + 1,2-diacylglycerolCMP + phosphatidylcholine\text{CDP-choline + 1,2-diacylglycerol} \rightarrow \text{CMP + phosphatidylcholine}

    KMK_M for CDP-choline: 17 μM .

ParameterDetails
EC Number2.7.8.2
Subcellular LocalizationEndoplasmic reticulum membrane
Regulatory ElementsPoly(dA-dT) promoter, inositol-responsive phospholipid synthesis regulation

Recombinant Production Systems

CPT1 has been heterologously expressed in multiple systems for functional studies and industrial applications .

Expression SystemVectorTagProduct CodePurity
Escherichia colipET-basedNoneCSB-EP005374SVG1>85%
BaculovirusBac-to-Bac™AviTag (biotinylated)CSB-BP005374SVG1>85%
Mammalian cellspcDNA3.1Not specifiedCSB-MP005374SVG1>85%

Key features of recombinant CPT1:

  • Stability: Stable in Tris-based buffer with 50% glycerol at -80°C .

  • Activity: Retains wild-type kinetic properties (e.g., KMK_M and CMP sensitivity) when overexpressed .

Role in Phosphatidylcholine Biosynthesis

  • Contributes 95% of PC synthesis via the CDP-choline pathway in S. cerevisiae .

  • Distinct from ethanolaminephosphotransferase (EPT1), which contributes only 5% of PC synthesis .

  • Regulatory Role: Mediates inositol-dependent downregulation of phospholipid synthesis genes (e.g., EPT1) .

Complementation Studies

  • T. denticola Cpt (homolog of CPT1) restores PC synthesis in S. cerevisiaecpt1 mutants, confirming functional conservation .

  • Chimeric CPT1/EPT1 proteins localize regulatory activity to the CDP-aminoalcohol binding domain .

Applications in Research

  1. Lipid Metabolism Studies: Used to dissect the Kennedy pathway and PC homeostasis .

  2. Enzyme Engineering: Chimeric constructs explore substrate specificity and regulatory domains .

  3. Host-Pathogen Interactions: Treponema denticola Cpt expression in yeast models reveals evolutionary conservation of PC synthesis pathways .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please contact us in advance for additional fees.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
CPT1; YNL130C; N1218; N1867; Cholinephosphotransferase 1; Aminoalcohol phosphotransferase CPT1; Diacylglycerol cholinephosphotransferase 1; Sn-1,2-diacylglycerol cholinephosphotransferase; CHOPT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-393
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
CPT1
Target Protein Sequence
MGFFIPQSSLGNLKLYKYQSDDRSFLSNHVLRPFWRKFATIFPLWMAPNLVTLLGFCFII FNVLTTLYYDPYFDQESPRWTYFSYAIGLFLYQTFDACDGMHARRTGQQGPLGELFDHCI DSINTTLSMIPVCSMTGMGYTYMTIFSQFAILCSFYLSTWEEYHTHKLYLAEFCGPVEGI IVLCISFIAVGIYGPQTIWHTKVAQFSWQDFVFDVETVHLMYAFCTGALIFNIVTAHTNV VRYYESQSTKSATPSKTAENISKAVNGLLPFFAYFSSIFTLVLIQPSFISLALILSIGFS VAFVVGRMIIAHLTMQPFPMVNFPFLIPTIQLVLYAFMVYVLDYQKGSIVSALVWMGLGL TLAIHGMFINDIIYDITTFLDIYALSIKHPKEI
Uniprot No.

Target Background

Function
Cholinephosphotransferase 1 (CPT1) catalyzes the final step in the CDP-choline pathway, leading to the production of phosphatidylcholine (PC). It preferentially utilizes CDP-monomethylethanolamine as the aminoalcohol substrate and exhibits highest activity towards di- and mono-unsaturated diacylglycerol species as lipid substrates. The CDP-choline pathway only contributes to net PC synthesis in the presence of exogenous choline. In the absence of exogenous choline, this pathway recycles choline from PC turnover and may contribute to maintaining the appropriate PC species composition.
Database Links

KEGG: sce:YNL130C

STRING: 4932.YNL130C

Protein Families
CDP-alcohol phosphatidyltransferase class-I family
Subcellular Location
Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Mitochondrion outer membrane; Multi-pass membrane protein.

Q&A

What is Saccharomyces cerevisiae Cholinephosphotransferase 1 (CPT1)?

Cholinephosphotransferase 1 (CPT1) is a key enzyme encoded by the CPT1 gene in Saccharomyces cerevisiae that catalyzes the final step in the CDP-choline pathway for phosphatidylcholine (PC) biosynthesis. Specifically, it transfers the phosphocholine moiety from CDP-choline to sn-1,2-diacylglycerol, resulting in the formation of phosphatidylcholine . This enzyme is distinctive from ethanolaminephosphotransferase, which catalyzes a similar reaction but with CDP-ethanolamine as the substrate.

The CPT1 gene has been cloned by genetic complementation using a yeast genomic library, and its product has been characterized as the structural gene for yeast cholinephosphotransferase. Biochemical studies have demonstrated that CPT1 is a membrane-associated enzyme primarily localized to the endoplasmic reticulum .

How does CPT1 differ from EPT1 in Saccharomyces cerevisiae?

CPT1 and EPT1 in S. cerevisiae represent distinct enzymes with overlapping but differentiated functions:

CharacteristicCPT1EPT1
Substrate specificityPrimarily uses CDP-cholineUses both CDP-choline and CDP-ethanolamine
Contribution to PC synthesis in vivoResponsible for ~95%Accounts for only ~5%
Function in PE synthesisNo rolePrimary enzyme for PE synthesis
Regulation by inositolRegulated by inositol levelsNot significantly regulated by inositol
Gene essentialityNonessential for growthNonessential for growth

While both enzymes can catalyze the cholinephosphotransferase reaction in vitro (each accounting for approximately 50% of measurable activity), in vivo studies with null mutations demonstrate that CPT1 is responsible for the vast majority (95%) of phosphatidylcholine synthesis via the CDP-choline pathway . The EPT1 gene product exhibits broader substrate specificity, being able to utilize both CDP-choline and CDP-ethanolamine as substrates, while CPT1 is more specific to CDP-choline.

What methods are used to isolate and characterize CPT1 mutants?

The isolation and characterization of CPT1 mutants typically involves a systematic approach combining genetic, biochemical, and molecular techniques:

  • Colony autoradiographic assay: A specialized assay was developed for screening S. cerevisiae mutants defective in sn-1,2-diacylglycerol cholinephosphotransferase activity. This method allows for high-throughput screening of yeast colonies for reduced CPT1 activity .

  • Complementation analysis: Mutant strains are crossed to determine complementation groups. In one study, 22 isolated mutants defective in cholinephosphotransferase activity were found to fall into three distinct complementation groups, with cpt1 being one of them .

  • Enzyme activity assays: Membrane preparations from wild-type and mutant strains are compared for cholinephosphotransferase activity using radiolabeled substrates. The cpt1 mutants typically show a 2-10 fold reduction in activity compared to wild-type strains .

  • Kinetic analysis: Detailed enzyme kinetics are performed to characterize the properties of residual activities in mutants, including apparent KM values for CDP-choline and sensitivity to inhibitors like CMP. Some cpt1 mutants display altered kinetic parameters, such as different apparent KM for CDP-choline and increased sensitivity to CMP inhibition .

  • Gene cloning: The CPT1 gene was cloned by genetic complementation of cpt1 mutants using yeast genomic libraries. Transformants are selected based on restoration of cholinephosphotransferase activity .

  • Insertional mutagenesis: Transposon (e.g., Tn5) mutagenesis and deletion mapping techniques are used to precisely locate the CPT1 gene within isolated DNA fragments. This approach localized CPT1 to a 1.2-2.4 kilobase region .

  • Integrative transformation: Characterized insertional mutations can be introduced into the yeast chromosome via integrative transformation to create defined genetic lesions for further study .

How can recombinant CPT1 be expressed and purified for biochemical studies?

The expression and purification of recombinant CPT1 requires specialized approaches due to its nature as a membrane-associated enzyme. The following methodology represents an effective approach:

  • Expression system selection:

    • For homologous expression, S. cerevisiae strains with cpt1 null mutations serve as ideal hosts to eliminate background activity

    • Plasmid-based expression using a range of promoters (constitutive or inducible) can be employed depending on experimental requirements

  • Promoter optimization:

    • For constitutive expression, modified versions of the ADH1 promoter can be used, as this promoter is active in the presence of fermentable carbon sources

    • For controlled expression, synthetic promoter libraries derived from the TEF1 promoter provide a range of expression levels (0.11-1.82 U/mg protein)

    • Inducible systems such as GAL1 can be employed when temporal control is needed, though these may be less practical for large-scale purification

  • Membrane protein extraction:

    • Cell disruption by mechanical methods (glass beads, French press)

    • Differential centrifugation to isolate membrane fractions

    • Detergent solubilization using optimized detergent:protein ratios

  • Purification strategies:

    • Affinity tags (His, FLAG, or TAP) can be fused to CPT1 to facilitate purification

    • Ion exchange chromatography and size exclusion chromatography as secondary purification steps

    • Activity assays at each purification step to track enzyme functionality

  • Activity preservation:

    • Inclusion of phospholipids in purification buffers to maintain enzyme stability

    • Optimization of pH, salt concentration, and glycerol content

  • Storage considerations:

    • Flash freezing in liquid nitrogen with cryoprotectants

    • Storage at -80°C in small aliquots to minimize freeze-thaw cycles

The purified recombinant CPT1 can then be used for detailed biochemical characterization, including substrate specificity studies, inhibitor screening, and structural investigations.

How does CPT1 contribute to phosphatidylcholine biosynthesis pathways in yeast?

CPT1 plays a central role in phosphatidylcholine biosynthesis in S. cerevisiae through the CDP-choline pathway (Kennedy pathway), which is one of the major routes for PC synthesis. In vivo studies using null mutations in the CPT1 and EPT1 genes have demonstrated that the CPT1 gene product is responsible for approximately 95% of phosphatidylcholine synthesis via the CDP-choline pathway, while the EPT1 gene product accounts for only about 5% .

The CDP-choline pathway in yeast consists of three sequential enzymatic steps:

  • Phosphorylation of choline by choline kinase (encoded by CKI1)

  • Conversion of phosphocholine to CDP-choline by CTP:phosphocholine cytidylyltransferase (encoded by PCT1)

  • Transfer of the phosphocholine moiety from CDP-choline to diacylglycerol by cholinephosphotransferase (encoded by CPT1)

In addition to the CDP-choline pathway, S. cerevisiae can synthesize PC through the methylation of phosphatidylethanolamine (PE) in a pathway that requires the sequential action of phosphatidylethanolamine methyltransferases (encoded by CHO2 and OPI3). This methylation pathway becomes particularly important when CPT1 function is compromised or when cells are grown in the absence of exogenous choline .

Interestingly, studies with chimeric CPT1/EPT1 enzymes have revealed that only chimeras expressing the CDP-aminoalcohol specificity region of CPT1 were capable of significant PC synthesis via the CDP-choline pathway in vivo, highlighting the importance of substrate specificity determinants in the CPT1 protein structure .

What is the role of CPT1 in regulating phospholipid homeostasis?

CPT1 serves as a key regulatory node in maintaining phospholipid homeostasis in S. cerevisiae, particularly in response to inositol availability. Analysis of phospholipids extracted from wild-type, cpt1-null (cpt-), and ept1-null (ept-) cells labeled with 32Pi has demonstrated that an intact CPT1 gene product is required for the pleiotropic regulation of phospholipid synthesis by inositol .

The regulatory mechanisms include:

  • Inositol-dependent regulation: CPT1 mediates the regulatory response of phospholipid biosynthesis to inositol levels. Studies with chimeric CPT1/EPT1 enzymes mapped this regulatory function to the CDP-aminoalcohol binding domain of CPT1 .

  • Coordination with choline uptake: Strains with dysfunctional cholinephosphotransferase enzymes display decreased levels of choline uptake, suggesting a feedback loop that coordinates choline import with ongoing PC biosynthesis .

  • Phospholipid composition regulation: The CPT1 gene product influences the relative proportions of different phospholipid species in cellular membranes, affecting membrane properties and function.

  • Integration with other metabolic pathways: CPT1 activity is integrated with other aspects of lipid metabolism, including diacylglycerol utilization and turnover of existing phospholipids.

This complex regulatory role positions CPT1 as a central player in maintaining appropriate phospholipid balance in response to changing environmental and metabolic conditions.

How does inositol regulate CPT1 activity and phospholipid synthesis?

Inositol is a critical regulatory molecule that affects phospholipid synthesis in S. cerevisiae, with CPT1 playing a central role in this regulatory response. The regulation of CPT1 by inositol influences the broader phospholipid biosynthetic network:

  • Transcriptional regulation: Inositol affects the expression levels of multiple genes involved in phospholipid biosynthesis, potentially including CPT1. This regulation often involves the transcriptional repressor Opi1p, which is sequestered to the ER in the absence of inositol but enters the nucleus to repress target genes when inositol is present.

  • CDP-aminoalcohol binding domain involvement: Studies with chimeric CPT1/EPT1 enzymes have mapped the regulatory region required for inositol-dependent regulation of phospholipid synthesis to the CDP-aminoalcohol binding domain of CPT1. This suggests that the substrate-binding region of CPT1 is not only important for catalysis but also plays a key role in regulatory responses .

  • Coordinate regulation: Analysis of phospholipids from wild-type, cpt-, and ept- cells labeled with 32Pi indicated that an intact CPT1 gene product is required for the pleiotropic regulation of phospholipid synthesis by inositol, suggesting CPT1 may influence the activity of other enzymes in the pathway .

  • Metabolic feedback: The presence of inositol affects the flux of carbon through different phospholipid biosynthetic pathways, with CPT1 activity being a key factor in determining which pathway predominates under specific conditions.

What genetic engineering strategies can be used to study CPT1 function?

Several sophisticated genetic engineering approaches have been developed to investigate CPT1 function in S. cerevisiae:

  • Null mutation analysis: Complete deletion of the CPT1 gene creates a clean genetic background for studying the consequences of CPT1 absence. Combined with metabolic labeling, this approach revealed that CPT1 is responsible for 95% of PC synthesis via the CDP-choline pathway in vivo .

  • Promoter replacement strategies: Fine-tuning CPT1 expression can be achieved by replacing its native promoter with engineered promoters of different strengths:

    • Synthetic promoter libraries derived from the strong constitutive TEF1 promoter provide a range of expression levels

    • Promoter replacement cassettes allow for chromosomal integration of these modified promoters

    • This approach enables precise adjustment of CPT1 expression levels to study dosage effects

  • Chimeric protein analysis: Construction of chimeric proteins between CPT1 and EPT1 has been instrumental in mapping functional domains:

    • Chimeras with diacylglycerol and CDP-aminoalcohol specificities both similar and distinct from parental enzymes were created

    • Only chimeras expressing the CDP-aminoalcohol specificity region of CPT1 were capable of PC synthesis via the CDP-choline pathway in vivo

    • This approach mapped the regulatory region required for inositol-dependent regulation to the CDP-aminoalcohol binding domain of CPT1

  • Site-directed mutagenesis: Targeted amino acid substitutions can identify critical residues for:

    • Catalytic activity

    • Substrate binding

    • Regulation by inositol

    • Protein-protein interactions

  • Regulated expression systems:

    • GAL1 promoter-based systems for inducible expression

    • Tetracycline-responsive systems for dose-dependent expression

    • Temperature-sensitive alleles for conditional expression

  • Global transcription machinery engineering (gTME): This approach introduces random mutations in transcription factors to perturb global gene expression, potentially revealing novel regulatory connections involving CPT1 .

  • Integration of reporter genes: Fusion of CPT1 with fluorescent proteins or epitope tags enables:

    • Subcellular localization studies

    • Protein-protein interaction analyses

    • Real-time monitoring of expression levels

These genetic engineering strategies provide powerful tools for dissecting CPT1 function and its integration within the complex network of phospholipid metabolism in yeast.

What metabolic labeling approaches are effective for studying CPT1-mediated phospholipid synthesis?

Metabolic labeling techniques provide powerful tools for investigating CPT1-mediated phospholipid synthesis in S. cerevisiae. These approaches allow researchers to track the flow of metabolites through biosynthetic pathways and quantify the contribution of specific enzymes like CPT1:

  • Radiolabeled precursor incorporation:

    • [3H]choline or [14C]choline: These labeled precursors enable specific tracking of phosphatidylcholine synthesis via the CDP-choline pathway where CPT1 functions

    • 32Pi: Global phospholipid labeling with radioactive phosphate allows for analysis of all phospholipid classes simultaneously, as demonstrated in studies comparing wild-type, cpt-, and ept- cells to elucidate the role of CPT1 in phospholipid regulation

    • [3H]inositol: Useful for monitoring phosphatidylinositol synthesis and its relationship to CPT1-mediated pathways

    • [14C]ethanolamine: Helps distinguish between CPT1 and EPT1 activities by tracking phosphatidylethanolamine synthesis

  • Pulse-chase experiments:

    • Short exposure to labeled precursors followed by chase with unlabeled compounds

    • Enables tracking of phospholipid turnover and remodeling

    • Can reveal the dynamic interplay between different phospholipid biosynthetic pathways

  • Dual-label experiments:

    • Simultaneous use of differently labeled precursors (e.g., [3H]choline and [14C]ethanolamine)

    • Allows direct comparison of fluxes through parallel pathways

    • Particularly useful for comparing CPT1 and EPT1 contributions

  • Stable isotope labeling:

    • 13C-labeled carbon sources or precursors

    • Combines with mass spectrometry for highly sensitive detection

    • Enables detailed flux analysis through metabolic networks

  • Time-course analysis:

    • Sampling at multiple time points after addition of labeled precursors

    • Reveals the kinetics of phospholipid synthesis and potential rate-limiting steps

    • Can identify regulatory points in the pathway

A typical protocol for studying CPT1-mediated phosphatidylcholine synthesis using [3H]choline includes:

  • Growing yeast cultures to mid-log phase

  • Adding [3H]choline to the culture medium

  • Incubating for defined time periods

  • Harvesting cells and extracting total lipids

  • Separating phospholipid classes by thin-layer chromatography

  • Quantifying radioactivity in phosphatidylcholine fractions

  • Comparing results between wild-type and mutant strains

This approach has been instrumental in establishing that the CPT1 gene product is responsible for approximately 95% of phosphatidylcholine synthesis via the CDP-choline pathway in vivo, while the EPT1 gene product accounts for only about 5% .

How can structural studies of CPT1 inform our understanding of its function?

Structural studies of CPT1 provide critical insights into the enzyme's mechanism, substrate specificity, and regulatory interactions. While the complete three-dimensional structure of S. cerevisiae CPT1 has not been fully determined, various approaches can be employed to gain structural information:

  • Domain mapping through chimeric enzymes:

    • Chimeric CPT1/EPT1 enzymes have been particularly informative in identifying functional domains

    • Studies have mapped the CDP-aminoalcohol specificity region of CPT1 as critical for PC synthesis

    • The CDP-aminoalcohol binding domain has also been identified as the regulatory region required for inositol-dependent regulation of phospholipid synthesis

  • Homology modeling:

    • Leveraging known structures of related phosphotransferases

    • Prediction of substrate binding pockets and catalytic residues

    • Generating testable hypotheses about structure-function relationships

  • Site-directed mutagenesis combined with activity assays:

    • Systematic mutation of predicted catalytic residues

    • Analysis of kinetic parameters (KM, Vmax) for mutant enzymes

    • CPT1 mutants have already shown altered kinetic parameters, such as different apparent KM values for CDP-choline and increased sensitivity to CMP inhibition

  • Protein modification and accessibility studies:

    • Chemical modification of specific amino acid residues

    • Proteolytic digestion patterns

    • Surface labeling techniques

  • Crystallization approaches for membrane proteins:

    • Detergent screening for optimal solubilization

    • Lipidic cubic phase crystallization

    • Nanodiscs or amphipol stabilization

  • Cryo-electron microscopy:

    • Single-particle analysis for purified CPT1

    • Potentially visualizing the enzyme in different conformational states

    • Integration with membrane environments

Structural information from these approaches can provide insights into:

  • Substrate recognition: Understanding how CPT1 specifically recognizes CDP-choline over CDP-ethanolamine, while EPT1 accommodates both substrates

  • Catalytic mechanism: Elucidating the precise steps in the phosphotransferase reaction

  • Membrane association: Determining how CPT1 interacts with the ER membrane

  • Regulatory interactions: Identifying potential binding sites for regulatory molecules or protein partners

  • Evolution of specificity: Comparing CPT1 structure with related enzymes to understand the evolution of substrate specificity

The integration of structural data with functional studies is essential for a comprehensive understanding of CPT1's role in phospholipid biosynthesis and cellular homeostasis.

How can CPT1 research inform broader studies of membrane biogenesis?

Research on S. cerevisiae CPT1 provides valuable insights that extend beyond this specific enzyme to inform our understanding of membrane biogenesis more broadly:

  • Model system advantages: S. cerevisiae serves as an excellent model organism for studying eukaryotic membrane biogenesis due to its genetic tractability and the conservation of many fundamental processes. CPT1 research in yeast can serve as a paradigm for understanding phospholipid synthesis regulation in higher eukaryotes .

  • Coordinate regulation mechanisms: Studies of CPT1 have revealed sophisticated regulatory networks that coordinate phospholipid synthesis with other cellular processes. For example, strains with dysfunctional cholinephosphotransferase enzymes display decreased levels of choline uptake, suggesting feedback loops between membrane biogenesis and nutrient acquisition .

  • Organelle membrane specialization: Understanding how CPT1 contributes to phosphatidylcholine synthesis provides insights into how cells generate and maintain the specific phospholipid compositions required for different organelle membranes.

  • Stress response integration: CPT1's regulation by inositol connects phospholipid metabolism to broader cellular stress response pathways, informing our understanding of how membrane composition adapts to environmental changes .

  • Translational potential: Insights from yeast CPT1 can be applied to understanding related processes in higher organisms, including humans. S. cerevisiae has been used as a model organism for studying human diseases such as cancer and as a tool for drug research .

  • Technological applications: Methodologies developed for studying CPT1, such as promoter engineering approaches and metabolic labeling techniques, can be applied to investigate other aspects of membrane biogenesis .

  • Systems biology framework: CPT1 research contributes to comprehensive models of lipid metabolism that integrate multiple pathways and regulatory mechanisms, advancing our ability to understand membrane biogenesis as an integrated system rather than isolated reactions.

By elucidating the molecular mechanisms governing CPT1 function and regulation, researchers gain valuable perspectives on the fundamental principles of membrane biogenesis that apply across eukaryotic systems.

What are the current challenges in studying recombinant CPT1 and how might they be addressed?

Despite significant progress in understanding CPT1 function, several challenges remain in the study of recombinant CPT1. These challenges and potential solutions include:

  • Membrane protein expression and purification:

    • Challenge: As a membrane-associated enzyme, CPT1 is difficult to express and purify in active form

    • Solutions:

      • Optimization of detergent conditions for solubilization

      • Use of membrane mimetics (nanodiscs, liposomes)

      • Expression with solubility-enhancing fusion partners

      • Development of cell-free expression systems optimized for membrane proteins

  • Structural characterization:

    • Challenge: Obtaining high-resolution structural information for membrane-associated phosphotransferases remains difficult

    • Solutions:

      • Application of cryo-electron microscopy

      • Crystallization trials with lipidic cubic phases

      • Hybrid approaches combining computational modeling with experimental constraints

      • NMR studies on specifically labeled domains

  • In vitro activity reconstitution:

    • Challenge: Reproducing the native activity levels and regulatory properties of CPT1 in vitro

    • Solutions:

      • Incorporating physiologically relevant lipid compositions in assay systems

      • Reconstitution with potential protein partners or regulators

      • Developing more sensitive assays for detecting phosphotransferase activity

  • Dynamics of regulation:

    • Challenge: Understanding the real-time dynamics of CPT1 regulation in response to changing cellular conditions

    • Solutions:

      • Development of fluorescent sensors for CPT1 activity

      • Single-cell analysis of phospholipid metabolism

      • Integration of multiple omics approaches (lipidomics, proteomics, transcriptomics)

  • Genetic redundancy:

    • Challenge: Partial functional overlap between CPT1 and EPT1 complicates interpretation of phenotypes

    • Solutions:

      • Creation of conditional double mutants

      • Tissue-specific or temporally controlled gene expression

      • Domain-specific mutations that affect specific aspects of enzyme function

  • Translation to higher eukaryotes:

    • Challenge: Extrapolating findings from yeast to mammalian systems

    • Solutions:

      • Comparative studies with mammalian CPT1 homologs

      • Development of humanized yeast models

      • Parallel studies in multiple model systems

  • Integration with metabolic networks:

    • Challenge: Understanding CPT1 function in the context of complex, interconnected metabolic networks

    • Solutions:

      • Application of systems biology approaches

      • Development of comprehensive mathematical models

      • Metabolic flux analysis using stable isotope labeling

Addressing these challenges will require interdisciplinary approaches that combine advanced genetic tools, biochemical techniques, structural biology methods, and systems-level analyses to fully elucidate CPT1 function and regulation.

What emerging technologies might advance CPT1 research in the near future?

Several cutting-edge technologies are poised to significantly advance CPT1 research in the coming years:

  • CRISPR-Cas9 genome editing with enhanced precision:

    • Base editing and prime editing for introducing specific mutations without double-strand breaks

    • Multiplex CRISPR for simultaneous modification of multiple genes in phospholipid synthesis pathways

    • CRISPRi/CRISPRa for reversible, tunable modulation of CPT1 expression

  • Advanced imaging technologies:

    • Super-resolution microscopy to visualize CPT1 localization within membrane microdomains

    • Correlative light and electron microscopy (CLEM) to connect CPT1 function with membrane ultrastructure

    • Expansion microscopy for enhanced spatial resolution of membrane-associated processes

  • Single-cell analysis platforms:

    • Single-cell lipidomics to reveal cell-to-cell variability in phospholipid profiles

    • Microfluidic systems for high-throughput screening of CPT1 variants

    • Single-cell transcriptomics to correlate CPT1 expression with broader gene expression programs

  • Computational and systems biology approaches:

    • Machine learning algorithms for predicting CPT1 interactions and regulatory networks

    • Whole-cell modeling incorporating detailed lipid metabolism pathways

    • Network analysis to identify emergent properties in phospholipid biosynthesis regulation

  • Synthetic biology tools:

    • De novo design of phospholipid biosynthetic pathways with engineered CPT1 variants

    • Optogenetic control of CPT1 activity for precise temporal regulation

    • Cell-free systems reconstituting complete phospholipid synthesis pathways

  • Biomolecular condensate research:

    • Investigation of potential phase separation in organizing phospholipid biosynthetic enzymes

    • Examination of CPT1 partitioning into membrane microdomains or protein assemblies

    • Engineering synthetic condensates to control CPT1 activity

  • Cryo-electron tomography:

    • Visualizing CPT1 in its native membrane environment at molecular resolution

    • Structural studies of CPT1 complexes within the endoplasmic reticulum

  • Improved mass spectrometry techniques:

    • MALDI-imaging mass spectrometry for spatial analysis of phospholipids

    • Ion mobility spectrometry-mass spectrometry for enhanced separation of lipid species

    • Targeted lipidomics with increased sensitivity for low-abundance phospholipid intermediates

  • Protein engineering approaches:

    • Directed evolution of CPT1 for enhanced activity or altered substrate specificity

    • Split protein complementation systems for studying CPT1 interactions

    • Designer membrane anchors for controlling CPT1 localization

These emerging technologies will enable researchers to address longstanding questions about CPT1 function and regulation with unprecedented precision and depth, potentially leading to transformative insights into phospholipid metabolism and membrane biogenesis.

What are the key takeaways from current CPT1 research in Saccharomyces cerevisiae?

Current research on Saccharomyces cerevisiae CPT1 has yielded several fundamental insights that advance our understanding of phospholipid metabolism and membrane biogenesis:

  • CPT1 is the primary enzyme responsible for phosphatidylcholine synthesis via the CDP-choline pathway in yeast, accounting for approximately 95% of this activity in vivo, while EPT1 contributes only about 5% despite both enzymes showing similar activities in vitro .

  • The CPT1 and EPT1 genes encode distinct enzymes with different substrate specificities - CPT1 is more specific for CDP-choline, while EPT1 can utilize both CDP-choline and CDP-ethanolamine as substrates .

  • The CPT1 gene product plays a crucial role in the pleiotropic regulation of phospholipid synthesis by inositol, with this regulatory function mapped specifically to the CDP-aminoalcohol binding domain of the protein .

  • Strains with dysfunctional cholinephosphotransferase enzymes display decreased levels of choline uptake, revealing a feedback mechanism that coordinates choline import with ongoing PC biosynthesis .

  • The CPT1 gene is nonessential for growth, indicating metabolic flexibility in phospholipid synthesis pathways, likely through the methylation of phosphatidylethanolamine as an alternative route for PC production .

  • Chimeric CPT1/EPT1 enzymes have been instrumental in mapping functional domains and understanding the structural basis for substrate specificity and regulatory functions .

  • Genetic engineering approaches, including promoter replacement and controlled expression systems, provide powerful tools for manipulating CPT1 expression and studying its function in vivo .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.