Recombinant Saccharomyces cerevisiae Copper transport protein CTR2 (CTR2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CTR2; YHR175W; Copper transport protein CTR2; Copper transporter 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
CTR2
Target Protein Sequence
MDDKKTWSTVTLRTFNQLVTSSLIGYSKKMDSMNHKMEGNAGHDHSDMHMGDGDDTCSMN MLFSWSYKNTCVVFEWWHIKTLPGLILSCLAIFGLAYLYEYLKYCVHKRQLSQRVLLPNR SLTKINQADKVSNSILYGLQVGFSFMLMLVFMTYNGWLMLAVVCGAIWGNYSWCTSYSPE IDDSSLACH
Uniprot No.

Target Background

Function
Provides bioavailable copper by mobilizing vacuolar copper stores and exporting them to the cytoplasm.
Gene References Into Functions
  1. GPD promoter-driven CTR2 transcription (different from the native CTR2 promoter) influences transcript degradation via nonsense-mediated mRNA decay. PMID: 25257758
  2. CTR2 regulates cytoplasmic copper levels. Copper tolerance in the upf1Δ mutant depends on CTR2. PMID: 23450501
  3. Ctr2 mobilizes vacuolar copper stores, a process dependent on conserved amino acid residues. PMID: 15494390
  4. The Ctr2-1 mutant (mislocalized to the plasma membrane) requires the Fre1 plasma membrane metalloreductase for Cu(I) import. PMID: 17553781
Database Links

KEGG: sce:YHR175W

STRING: 4932.YHR175W

Protein Families
Copper transporter (Ctr) (TC 1.A.56) family, SLC31A subfamily
Subcellular Location
Vacuole membrane; Multi-pass membrane protein.

Q&A

What is the primary function of CTR2 in Saccharomyces cerevisiae?

CTR2 functions as a low-affinity copper transporter in Saccharomyces cerevisiae, primarily mediating the mobilization of copper ions stored in vacuoles. This function is crucial for copper homeostasis, as it allows cells to access stored copper during periods of copper deficiency. Unlike high-affinity copper transporters that import extracellular copper, CTR2 plays a specialized role in mobilizing intracellular copper reserves, thereby helping yeast cells resist copper starvation conditions .

How does CTR2 differ from other copper transporters in yeast?

CTR2 differs from other copper transporters such as CTR1 and CTR3 in several key aspects:

  • Affinity: CTR2 is a low-affinity copper transporter, whereas CTR1 and CTR3 are high-affinity transporters.

  • Localization: CTR2 is primarily localized to the vacuolar membrane, while CTR1 and CTR3 are found on the plasma membrane.

  • Function: CTR2 mobilizes stored intracellular copper from vacuoles, whereas CTR1 and CTR3 import extracellular copper into the cell.

  • Structure: While sharing some structural similarities with CTR1, CTR2 lacks the metal-binding ecto-domain rich in methionine and histidine clusters that contribute to high-affinity copper uptake .

How is CTR2 expression regulated in response to copper availability?

CTR2 expression is dynamically regulated in response to environmental copper levels:

  • Under copper deficiency conditions, CTR2 gene transcription is upregulated to increase mobilization of stored copper from vacuoles.

  • During copper overload, CTR2 transcription is downregulated to prevent excessive copper mobilization.

  • This regulation is mediated by the copper-sensing transcription factor Mac1p, which activates CTR2 expression in response to copper deficiency.

  • Mac1p occupies the CTR2 promoter region despite the absence of consensus Mac1p binding sequences, as demonstrated by chromatin immunoprecipitation (ChIP) assays .

What methodologies are most effective for studying CTR2 regulation mechanisms?

To comprehensively investigate CTR2 regulation mechanisms, researchers should employ a multi-faceted approach:

  • Transcriptional analysis using RT-qPCR to quantify CTR2 mRNA levels under varying copper conditions.

  • Chromatin immunoprecipitation (ChIP) assays to identify transcription factor binding to the CTR2 promoter, particularly focusing on Mac1p occupation.

  • Reporter gene assays using the CTR2 promoter fused to reporter genes (e.g., lacZ or luciferase) to measure promoter activity.

  • Genetic approaches using deletion mutants (e.g., mac1Δ strains) to verify the role of specific transcription factors.

  • Copper chelation experiments using chelators like bathocuproine disulfonate (BCS) to induce copper deficiency and monitor CTR2 expression responses.

The combination of these techniques provides robust validation of regulatory mechanisms. For instance, chromatin immunoprecipitation assays have demonstrated that Mac1p occupies the CTR2 promoter region despite the absence of consensus Mac1p binding sequences, providing insight into non-canonical regulatory mechanisms .

How does CTR2 functionally interact with other components of copper homeostasis pathways?

CTR2 functions within an integrated network of copper homeostasis proteins:

  • Relationship with CCC2: Studies of CCC2 deletion strains (encoding a Cu²⁺-transporting P-type ATPase) revealed significant impacts on multiple cellular processes including iron ion homeostasis, stress response, and organization of mitochondrial respiratory chain complex IV, demonstrating the interconnected nature of copper and iron metabolism .

  • Coordination with CTR1: While mammalian systems show direct interaction between CTR1 and CTR2, in yeast, these transporters function in complementary roles—CTR1 importing extracellular copper and CTR2 mobilizing vacuolar copper stores.

  • Integration with copper chaperones: Upon mobilization by CTR2, copper ions are likely distributed via copper chaperones (e.g., Atx1p, Ccs1p) to copper-dependent enzymes and proteins.

  • Metabolic integration: Transcriptomic analysis reveals that alterations in copper availability affect sulfur compound, methionine, and cysteine biosynthetic processes, indicating broader metabolic connections beyond direct copper handling .

What are the challenges in expressing and purifying recombinant CTR2 for structural studies?

Researchers face several significant challenges when expressing and purifying recombinant CTR2:

  • Membrane protein isolation: As a transmembrane protein with three predicted transmembrane domains, CTR2 presents inherent challenges for solubilization and purification while maintaining native conformation.

  • Expression system selection: While E. coli offers high protein yields, eukaryotic expression systems (including S. cerevisiae itself) may provide better post-translational modifications and proper folding.

  • Detergent optimization: Identifying appropriate detergents for extraction and stabilization requires extensive screening, with milder detergents like n-dodecyl-β-D-maltoside (DDM) often preferred to preserve functionality.

  • Functional verification: Confirming that purified CTR2 retains copper transport capability necessitates development of appropriate reconstitution systems and transport assays.

  • Stability considerations: The presence of the M-X₃-M motif in the second transmembrane domain, which binds copper, can affect protein stability during purification if not properly accounted for in buffer compositions .

What are the optimal conditions for inducing CTR2 expression in recombinant systems?

Optimizing CTR2 expression in recombinant systems requires careful consideration of:

  • Copper concentrations: To maximize CTR2 expression, cultures should be grown under copper-limited conditions, which can be achieved using copper chelators such as bathocuproine disulfonate (BCS) at concentrations of 50-200 μM.

  • Expression system: The GAL1 promoter system in S. cerevisiae provides tight regulation and strong induction with galactose, making it suitable for controlled CTR2 expression.

  • Growth phase: CTR2 expression is most efficiently induced during early to mid-log phase (OD₆₀₀ of 0.6-0.8).

  • Mac1p co-expression: Since Mac1p regulates CTR2 expression, co-expression of Mac1p can enhance CTR2 yields, particularly in copper-limited conditions. Studies have shown that overexpression of Mac1p upregulates CTR2 transcription and partially complements growth defects in copper-deficient strains .

  • Temperature: Lower induction temperatures (20-25°C rather than 30°C) may increase proper folding and functional expression of the membrane protein.

How can researchers effectively study copper mobilization from vacuoles mediated by CTR2?

Studying CTR2-mediated vacuolar copper mobilization requires specialized techniques:

  • Vacuole isolation: Purify intact vacuoles from yeast cells using Ficoll gradient centrifugation, followed by copper content analysis via inductively coupled plasma mass spectrometry (ICP-MS) or atomic absorption spectroscopy.

  • Fluorescent copper probes: Utilize copper-specific fluorescent probes such as Coppersensor-3 (CS3) to visualize changes in copper distribution. This approach has been used effectively to demonstrate differences in copper localization patterns in CTR2-deficient cells .

  • Genetic approaches:

    • Compare wild-type strains to ctr2Δ mutants under copper-limited conditions

    • Use inducible CTR2 expression systems to monitor real-time copper mobilization

    • Employ CTR2 variants with mutations in the M-X₃-M motif to assess functional impacts

  • Vacuolar pH monitoring: Since copper transport may be influenced by pH gradients, use pH-sensitive fluorescent probes to monitor vacuolar pH concurrently with copper mobilization.

  • In vitro reconstitution: Reconstitute purified CTR2 into proteoliposomes loaded with copper to directly measure transport activity across membranes.

What techniques are most effective for visualizing CTR2 localization and trafficking?

Multiple complementary approaches can be employed to visualize CTR2 localization and trafficking:

  • Fluorescent protein tagging: C-terminal fusion of GFP or mCherry to CTR2, ensuring the tag doesn't interfere with localization signals or protein function.

  • Immunofluorescence microscopy: Using antibodies against CTR2 or epitope tags (HA, Myc) inserted into non-critical regions of the protein.

  • Co-localization studies: Combine CTR2 visualization with markers for various cellular compartments:

    • Vacuolar membrane: Vph1-RFP

    • Endosomal compartments: Pep12-GFP

    • Golgi: Sec7-RFP

    • ER: Sec61-GFP

  • Live-cell imaging: Monitor trafficking using time-lapse microscopy under varying copper conditions to observe dynamic changes in localization.

  • Electron microscopy: Immuno-gold labeling of CTR2 for high-resolution localization studies, particularly useful for precise membrane topology determination.

  • Fractionation approaches: Combine visual techniques with biochemical fractionation and western blotting to confirm the presence of CTR2 in specific cellular compartments .

How should researchers interpret transcriptomic data related to CTR2 and copper homeostasis?

Interpreting transcriptomic data in the context of CTR2 and copper homeostasis requires careful analytical approaches:

  • Clustering analysis: Apply different clustering algorithms to identify patterns of co-regulated genes. Studies have shown that copper-responsive genes often cluster into functional groups related to respiration, stress response, and iron homeostasis .

  • Pathway enrichment: Utilize tools like GO term analysis or KEGG pathway mapping to identify significantly affected processes. Recent research has identified sulfur compound, methionine, and cysteine biosynthetic processes as significantly affected by copper availability .

  • Temporal dynamics: Analyze gene expression changes across multiple time points following copper addition or depletion to distinguish primary from secondary responses.

  • Integration with regulome data: Combine transcriptomic data with information about transcription factor binding sites (particularly Mac1p) to construct regulatory networks. This approach has revealed extensive re-wiring of transcriptional organization in response to copper availability .

  • Cross-reference with proteomics: Validate transcriptional changes with corresponding protein-level alterations, particularly for post-transcriptionally regulated components.

  • Comparative analysis: Compare transcriptional profiles between wild-type and mutant strains (e.g., ctr2Δ, mac1Δ) to identify CTR2-dependent responses.

What control experiments are essential when studying CTR2 function?

When investigating CTR2 function, the following controls are essential for rigorous experimental design:

  • Strain controls:

    • Wild-type strain (positive control)

    • ctr2Δ strain (negative control)

    • ctr2Δ strain complemented with CTR2 (rescue control)

    • Strains with CTR2 mutations in functional domains (e.g., M-X₃-M motif)

  • Copper condition controls:

    • Copper-limited media (using chelators like BCS)

    • Copper-replete media (basal conditions)

    • Copper-excess media (using CuSO₄ supplementation)

    • Metal specificity controls using other metals (Zn, Fe) to demonstrate copper specificity

  • Localization controls:

    • Vacuolar membrane markers to confirm CTR2 localization

    • Controls for potential mislocalization due to tagging or overexpression

  • Functional assays:

    • Copper measurements in isolated vacuoles

    • Growth assays under copper limitation

    • Expression analysis of copper-dependent enzymes (e.g., Cu/Zn SOD)

  • Genetic interaction controls:

    • mac1Δ strains to assess regulatory dependence

    • Combination with mutations in other copper homeostasis genes

How can researchers distinguish between direct and indirect effects of CTR2 deletion on cellular copper distribution?

Distinguishing direct from indirect effects of CTR2 deletion requires systematic approaches:

  • Temporal studies: Monitor changes immediately following inducible CTR2 deletion or expression to identify primary effects before compensatory mechanisms activate.

  • Subcellular fractionation: Quantify copper content in isolated organelles (vacuoles, mitochondria, cytosol) from wild-type and ctr2Δ strains to map compartment-specific changes.

  • Genetic rescue experiments: Express CTR2 with varying functional domains to determine which aspects of the phenotype are directly rescued.

  • Acute vs. chronic effects: Compare acute CTR2 inhibition (using inducible systems) with long-term deletion to distinguish adaptive responses from direct consequences.

  • Cross-complementation experiments: Test whether related transporters can substitute for CTR2 function, helping define specific roles.

  • Epistasis analysis: Construct double mutants with other copper homeostasis genes to determine pathway relationships and functional hierarchy.

  • Direct copper flux measurements: Use radioisotope (⁶⁴Cu) tracing to measure specific transport activities and distinguish storage from mobilization defects .

What are the promising approaches for developing CTR2-based biotechnological applications?

Several promising approaches leverage CTR2 biology for biotechnological applications:

  • Bioremediation systems: Engineered yeast with modified CTR2 expression could enhance copper bioaccumulation for environmental remediation of copper-contaminated sites.

  • Biosensors: CTR2 promoter-reporter constructs can function as sensitive biosensors for copper availability in environmental samples or industrial processes.

  • Metabolic engineering: Manipulating CTR2 and copper homeostasis may enhance production of copper-dependent enzymes in industrial strains, particularly for:

    • Laccases for biofuel production

    • Oxidases for pharmaceutical precursor synthesis

    • Copper-dependent antimicrobial compounds

  • Copper hyperaccumulation: Strains with enhanced vacuolar copper storage via CTR2 regulation could serve as living copper repositories for bioextraction.

  • Model systems for human disease: Given the conservation between yeast and human copper transport systems, engineered CTR2 variants could model genetic copper disorders like Wilson's or Menkes disease .

How might advanced techniques like CRISPR-Cas9 genomic editing advance CTR2 research?

CRISPR-Cas9 technology offers transformative approaches for CTR2 research:

  • Precise genomic modifications: Create point mutations in key functional domains (e.g., M-X₃-M motif) while maintaining native expression levels, avoiding artifacts from overexpression systems.

  • Regulatory element editing: Modify CTR2 promoter elements to dissect specific transcription factor binding sites, particularly for understanding non-canonical Mac1p regulation.

  • Fluorescent tagging: Introduce fluorescent protein tags at the endogenous locus for physiologically relevant localization studies.

  • Multiplex editing: Simultaneously modify multiple components of copper homeostasis pathways to investigate genetic interactions and redundancies.

  • Inducible systems: Create precisely controlled expression systems using CRISPR interference (CRISPRi) or CRISPR activation (CRISPRa) to modulate CTR2 levels without genetic deletion.

  • High-throughput screening: Generate CRISPR-based libraries to identify new genetic interactions with CTR2 under varied copper conditions .

What are the most significant unanswered questions regarding CTR2 function and regulation?

Several critical questions remain unresolved in CTR2 research:

  • Structural basis of transport: The precise mechanism by which CTR2 transports copper across the vacuolar membrane remains unclear, particularly how the M-X₃-M motif contributes to transport specificity and efficiency.

  • Regulation beyond transcription: While transcriptional regulation by Mac1p is established, post-translational modifications and protein-protein interactions that may regulate CTR2 activity remain largely unexplored.

  • Sensing mechanisms: How CTR2 or associated proteins sense vacuolar copper levels to regulate transport activity is not fully understood.

  • Evolutionary relationship: The functional relationship between yeast CTR2 and mammalian CTR2 requires further clarification, particularly given that mammalian CTR2 appears to function by regulating CTR1 processing rather than directly transporting copper .

  • Physiological triggers: Beyond laboratory-induced copper depletion, the natural physiological conditions that trigger CTR2-mediated copper mobilization in yeast ecosystems remain to be established.

  • Integration with metabolic networks: The mechanisms connecting CTR2 function to sulfur metabolism, particularly methionine and cysteine biosynthesis pathways, represent an important area for further investigation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.