Recombinant Saccharomyces cerevisiae CTP-dependent diacylglycerol kinase 1 (DGK1)

Shipped with Ice Packs
In Stock

Description

Enzymatic Activity and Kinetics

DGK1 exhibits unique biochemical properties:

  • Phosphate donor specificity: Uses CTP (not ATP) with an apparent KmK_m of 0.3 mM for CTP .

  • DAG kinetics: Positive cooperativity (Hill coefficient = 2.5) with an apparent KmK_m of 6.5 mol% for DAG .

  • Cofactor requirements: Dependent on Ca2+^{2+} or Mg2+^{2+} ions for activity .

  • Inhibitors:

    • Competitive inhibition by dCTP (Ki=0.4K_i = 0.4 mM) .

    • Potent inhibition by NN-ethylmaleimide (thiol-modifying agent) .

ParameterValueConditions
pH optimum7.0–7.5In vitro assay
Temperature stabilityLabile above 40°C
Specific activity0.018 ± 0.002 units/mgWild-type cell extracts

Regulatory Mechanisms

DGK1 activity is tightly regulated at transcriptional and post-translational levels:

  • Transcriptional regulation:

    • Reb1p transcription factor binds the DGK1 promoter (consensus sequence: CGGGTAA at −166 to −160) .

    • Mutations in the Reb1p-binding site reduce DGK1 expression by 8.6-fold, impairing DAG kinase activity and lipid metabolism .

  • Post-translational modification:

    • Phosphorylation by casein kinase II (CKII) modulates enzyme activity .

Functional Roles in Lipid Metabolism

DGK1 maintains lipid homeostasis through:

  • PA/DAG balance: Converts DAG to PA, counteracting PAH1 phosphatase to regulate nuclear/ER membrane expansion .

  • Triacylglycerol (TAG) mobilization: Supports phospholipid synthesis during growth resumption from stasis, especially when de novo fatty acid synthesis is inhibited .

  • Toxicity mitigation: Reduces DAG accumulation, which is toxic at high levels .

  • Domain-function analysis: The CTP transferase domain alone is sufficient for catalytic activity .

  • Mutational studies: R76A, K77A, D177A, and G184A mutations abolish enzyme activity .

  • Membrane interactions: Activity is stimulated by phospholipids (e.g., phosphatidylcholine) and inhibited by CDP-DAG or sphingoid bases .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary based on the purchasing method or location. Please contact your local distributors for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate this need in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
DGK1; HSD1; YOR311C; O6111; CTP-dependent diacylglycerol kinase 1; Diglyceride kinase 1; DAG kinase 1; High-copy suppressor of SLY1 defect protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
DGK1
Target Protein Sequence
MGTEDAIALPNSTLEPRTEAKQRLSSKSHQVSAKVTIPAKEEISSSDDDAHVPVTEIHLK SHEWFGDFITKHEIPRKVFHSSIGFITLYLYTQGINYKNVLWPLIYAFIILFILDLIRLN WPFFNMLYCRTVGALMRKKEIHTYNGVLWYILGLIFSFNFFSKDVTLISLFLLSWSDTAA ATIGRKYGHLTPKVARNKSLAGSIAAFTVGVITCWVFYGYFVPAYSYVNKPGEIQWSPET SRLSLNMLSLLGGVVAALSEGIDLFNWDDNFTIPVLSSLFMNAVIKTFKK
Uniprot No.

Target Background

Function
CTP-dependent diacylglycerol kinase 1 (DGK1) is a crucial enzyme in Saccharomyces cerevisiae that catalyzes the phosphorylation of diacylglycerol (DAG) to phosphatidate (PA). This activity regulates phosphatidate levels at the nuclear envelope. DGK1 counteracts the activity of PA phosphatase PAH1/SMP2, thereby controlling the levels of PA and DAG, which are essential for the synthesis of triacylglycerol and membrane phospholipids. It is also likely involved in vesicle trafficking between the endoplasmic reticulum and the Golgi apparatus. DGK1 is required to convert triacylglycerol-derived DAG to PA for phospholipid synthesis during growth resumption from stationary phase when de novo fatty acid synthesis is absent. Additionally, it plays a role in the resistance to nickel chloride and nalidixic acid.
Gene References Into Functions
  1. This research demonstrates that CKII-mediated phosphorylation of Dgk1 regulates its function in the production of Phosphatidic Acid PMID: 27834677
  2. DGK1-encoded diacylglycerol kinase activity is essential for converting triacylglycerol-derived diacylglycerol to phosphatidate for phospholipid synthesis PMID: 21071438
  3. Diacylglycerol kinase activity was stimulated by major membrane phospholipids and was inhibited by CDP-diacylglycerol and sphingoid bases PMID: 18458076
Database Links

KEGG: sce:YOR311C

STRING: 4932.YOR311C

Protein Families
DGK1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Nucleus membrane; Multi-pass membrane protein.

Q&A

What is Saccharomyces cerevisiae DGK1 and how does it function?

The Saccharomyces cerevisiae DGK1 gene encodes a diacylglycerol kinase enzyme that catalyzes the formation of phosphatidate (PA) from diacylglycerol (DAG) . The enzyme plays a critical role in phospholipid metabolism by converting DAG, a fusogenic lipid, to PA, which serves as an important intermediate in membrane phospholipid synthesis . Unlike mammalian diacylglycerol kinases, the yeast enzyme possesses the unique characteristic of utilizing CTP, rather than ATP, as the phosphate donor in the reaction . This CTP-dependent mechanism represents a fundamental difference in how yeast metabolizes lipid intermediates compared to other organisms.

What is the structural organization of DGK1?

DGK1 encodes a 32.8-kDa protein with distinct structural domains. The protein structure includes a short N-terminal hydrophilic region followed by four putative transmembrane domains . The latter portion contains a predicted CTP transferase domain that is characteristic of enzymes utilizing CTP as a substrate . This CTP transferase domain is shared with two other S. cerevisiae proteins: the CDS1-encoded CDP-DAG synthase and the SEC59-encoded dolichol kinase . Deletion analysis has demonstrated that the CTP transferase domain is sufficient for diacylglycerol kinase activity, highlighting its importance in enzyme function .

What are the optimal conditions for DGK1 enzymatic activity?

The DGK1-encoded enzyme exhibits specific biochemical properties:

ParameterOptimal Condition/Value
pH optimum7.0-7.5
Ion requirementCa²⁺ or Mg²⁺
Temperature stabilityLabile above 40°C
Kinetics with diacylglycerolPositive cooperative (Hill number = 2.5)
Apparent Km for diacylglycerol6.5 mol%
Kinetics with CTPSaturation kinetics
Apparent Km for CTP0.3 mM
InhibitorsN-ethylmaleimide, CDP-diacylglycerol, sphingoid bases
ActivatorsMajor membrane phospholipids

The enzyme shows positive cooperative kinetics with respect to diacylglycerol with an apparent Km of 6.5 mol%, suggesting allosteric regulation in response to substrate concentration . With respect to CTP, the enzyme follows saturation kinetics with an apparent Km of 0.3 mM . Interestingly, dCTP functions both as a substrate (apparent Km = 0.4 mM) and as a competitive inhibitor (apparent Ki = 0.4 mM) of the enzyme .

How do mutations in the CTP transferase domain affect DGK1 activity?

Point mutations in conserved residues within the CTP transferase domain have been shown to abolish diacylglycerol kinase activity . Specifically, mutations R76A, K77A, D177A, and G184A result in complete loss of enzymatic function . These residues are likely critical for substrate binding or catalysis within the active site. The dependence of DGK1 function on these specific residues provides strong evidence that the in vivo functions of Dgk1p are specifically due to its diacylglycerol kinase activity rather than any secondary functions of the protein . This information is valuable for researchers designing experiments to examine structure-function relationships or creating functionally deficient mutants for phenotypic analysis.

What is the relationship between DGK1 and PAH1 in phospholipid homeostasis?

DGK1 and PAH1 function in an antagonistic manner to regulate phospholipid homeostasis:

  • PAH1 encodes phosphatidate phosphatase, which converts PA to DAG, while DGK1 catalyzes the reverse reaction, converting DAG to PA .

  • A dgk1Δ mutation bypasses the phenotypes caused by the pah1Δ mutation, which include elevated levels of PA, derepression of the INO1 gene, and nuclear/ER membrane expansion .

  • Overexpression of DGK1 causes nuclear/ER membrane expansion phenotypes similar to those exhibited by cells carrying mutations in PAH1-encoded PA phosphatase activity .

This reciprocal relationship creates a regulatory circuit controlling the balance between PA and DAG, which are both critical lipid intermediates with distinct roles in membrane structure and function. The interplay between these enzymes allows yeast cells to fine-tune membrane phospholipid composition in response to changing physiological conditions or growth states .

What role does DGK1 play in triacylglycerol mobilization and growth?

In Saccharomyces cerevisiae, triacylglycerol mobilization for phospholipid synthesis occurs during growth resumption from stationary phase, and this metabolism is essential in the absence of de novo fatty acid synthesis . DGK1-encoded diacylglycerol kinase activity is required to convert triacylglycerol-derived diacylglycerol to phosphatidate for phospholipid synthesis . Cells lacking diacylglycerol kinase activity (dgk1Δ mutation) fail to resume growth in the presence of cerulenin, a fatty acid synthesis inhibitor .

Lipid analysis data has demonstrated that dgk1Δ mutant cells do not mobilize triacylglycerol for membrane phospholipid synthesis and instead accumulate diacylglycerol . This indicates that the conversion of DAG to PA by Dgk1 is a rate-limiting step in channeling triacylglycerol-derived DAG into phospholipid synthesis pathways during growth resumption, particularly when de novo fatty acid synthesis is compromised.

How does DGK1 influence membrane fusion events?

DGK1 functions as a negative regulator of vacuole fusion through the production of PA at the expense of depleting DAG . DAG is a fusogenic lipid that promotes membrane fusion, while PA can inhibit fusion events . The deletion of DGK1 (dgk1Δ) leads to a marked increase in vacuole fusion, which is attributed to elevated DAG levels . This enhancement in fusion is accompanied by increased resistance to the inhibitory effects of PA as well as inhibitors of Ypt7 activity, a key GTPase involved in the fusion process .

The regulatory role of Dgk1 in membrane fusion provides insight into how lipid metabolism can directly impact membrane dynamics and organelle morphology. By controlling the balance between DAG and PA, Dgk1 may serve as a molecular switch that determines whether membranes are primed for fusion or maintained as separate entities, thus influencing various membrane remodeling events in the cell.

What methods are most effective for studying DGK1 enzymatic activity?

The DAG kinase reaction can be effectively studied using radioisotope-based assays with [γ-³²P]CTP as the phosphate donor and dioleoyl-DAG as the lipid acceptor . Following the reaction, the chloroform-soluble product (phosphatidate) can be analyzed by thin-layer chromatography (TLC) and quantified by phosphorimaging analysis . This approach allows for the dose-dependent measurement of PA formation from CTP and DAG.

For optimal assay conditions:

  • The enzyme reaction should be conducted at pH 7.0-7.5 with either Ca²⁺ or Mg²⁺ ions present .

  • Reactions should be performed below 40°C to prevent enzyme denaturation .

  • The inclusion of membrane phospholipids can stimulate activity, while avoiding CDP-diacylglycerol and sphingoid bases can prevent inhibition .

For overexpression and purification purposes, the galactose-inducible GAL1/10 promoter has been successfully used for DGK1 expression from high copy number plasmids (e.g., YEplac181-GAL1/10-DGK1), resulting in a massive increase in DAG kinase activity . The specific activity of DAG kinase in the membrane fraction of galactose-grown cells bearing this plasmid has been reported at approximately 130 ± 2.7 units/mg, representing a 7222-fold purification relative to wild-type cells .

How can researchers analyze the localization and dynamics of DGK1?

To study DGK1 localization and dynamics, researchers can employ both microscopy-based and biochemical approaches:

  • Fluorescent protein tagging: Dgk1-GFP fusion proteins can be visualized in living cells using fluorescence microscopy. This approach has revealed the ribbon-like ER localization pattern as well as potential vacuolar association .

  • Cell fractionation and immunoblotting: This method involves separating cellular components into crude lysate, cytosol, vacuoles, total membrane pool, and microsomes containing endoplasmic reticulum, followed by immunoblotting with anti-tag antibodies (e.g., anti-HA for Dgk1-HA) .

  • Co-localization studies: Using vacuolar markers such as FM4-64 in conjunction with Dgk1-GFP allows for assessment of the degree of vacuole association .

  • Enrichment markers: Ypt7 can serve as an enrichment marker for vacuoles, while Sec61 can be used as a marker for resident endoplasmic reticulum components when verifying fractionation quality .

These complementary approaches provide a comprehensive view of DGK1 localization and can help determine whether the enzyme's distribution changes under different physiological conditions or in response to genetic perturbations.

What expression systems are recommended for recombinant DGK1 production?

For recombinant expression of DGK1 in yeast, the galactose-inducible GAL1/10 promoter system has proven highly effective . This system allows for tight regulation of expression, with minimal expression in glucose-containing media and strong induction upon addition of galactose. Both low copy (YCplac111) and high copy (YEplac181) vectors containing GAL1/10-DGK1 constructs have been successfully employed .

For induction protocol:

  • Grow cells to exponential phase (A₆₀₀ ~0.5) in synthetic medium with 2% raffinose as a carbon source.

  • Add galactose to a final concentration of 2% to induce expression.

  • Incubate for 24 hours to allow for maximal protein production .

This approach has yielded membrane preparations with DAG kinase specific activity of approximately 130 ± 2.7 units/mg, representing a 7222-fold increase over wild-type levels . This high level of expression facilitates biochemical characterization and is approximately 100-fold greater than the activities of other membrane-associated phospholipid synthesis enzymes in similar preparations .

What strategies can be used to study DGK1 structure-function relationships?

Several approaches have been successfully employed to investigate DGK1 structure-function relationships:

  • Truncation mutants: Constructs such as DGK1Δ66, DGK1Δ70, and DGK1Δ77 have been used to determine the minimal functional domains required for activity .

  • Site-directed mutagenesis: Point mutations in conserved residues (R76A, K77A, D177A, and G184A) have identified critical amino acids within the CTP transferase domain .

  • Domain swapping: The CTP transferase domain shares similarities with those in SEC59-encoded dolichol kinase and CDS1-encoded CDP-diacylglycerol synthase, making it amenable to domain swapping experiments to determine specificity determinants .

  • Promoter substitution: Replacing the native DGK1 promoter with regulatable promoters like GAL1/10 allows for controlled expression to study dosage effects .

These approaches, combined with enzymatic activity assays and phenotypic analyses, provide powerful tools for dissecting the molecular mechanisms underlying DGK1 function and regulation.

How is DGK1 activity regulated in response to changing metabolic conditions?

The regulation of DGK1 activity involves several mechanisms:

  • Substrate availability: The positive cooperative kinetics with respect to diacylglycerol (Hill number = 2.5) suggests that the enzyme becomes more active as DAG concentrations increase, potentially serving as a feedback mechanism to prevent excessive DAG accumulation .

  • Lipid effectors: DGK1 activity is stimulated by major membrane phospholipids and inhibited by CDP-diacylglycerol and sphingoid bases, indicating integration with broader lipid metabolic networks .

  • Metabolic state: DGK1 function is particularly important during transitions between growth phases, especially during resumption from stationary phase when triacylglycerol stores are mobilized for membrane synthesis .

  • Antagonistic relationship with PAH1: The opposing actions of DGK1 and PAH1 create a regulatory circuit that controls the balance between PA and DAG levels .

This multilayered regulation allows DGK1 to respond dynamically to cellular needs for phospholipid synthesis and membrane remodeling under different physiological conditions.

What are the consequences of DGK1 deletion or overexpression?

The deletion or overexpression of DGK1 results in distinct phenotypes:

DGK1 deletion (dgk1Δ):

  • Failure to resume growth in the presence of cerulenin (fatty acid synthesis inhibitor)

  • Inability to mobilize triacylglycerol for membrane phospholipid synthesis

  • Accumulation of diacylglycerol

  • Suppression of phenotypes associated with pah1Δ mutation

  • Enhanced vacuole fusion attributed to elevated DAG levels

  • Increased resistance to inhibitory effects of PA and inhibitors of Ypt7 activity

DGK1 overexpression:

  • Nuclear/ER membrane expansion phenotype similar to that exhibited by cells with mutations in PAH1-encoded PA phosphatase activity

  • Massive increase in DAG kinase activity (up to 7222-fold increase over wild-type levels)

  • Potential reduction in DAG levels and increase in PA levels, affecting membrane fusion dynamics

These findings highlight the critical role of DGK1 in maintaining proper lipid homeostasis and membrane dynamics, with implications for understanding broader aspects of cellular physiology and adaptation to changing environmental conditions.

What are the current gaps in understanding DGK1 function?

Despite significant advances in characterizing DGK1, several knowledge gaps remain:

  • The precise structural basis for CTP preference over ATP has not been fully elucidated.

  • The mechanisms regulating DGK1 expression and activity in response to different growth conditions and stresses need further clarification.

  • The complete interactome of DGK1, including potential protein-protein interactions that might modulate its function, remains to be established.

  • The evolutionary significance of the CTP-dependent mechanism in yeast versus the ATP-dependent mechanism in other organisms requires additional comparative analysis.

What emerging technologies might advance DGK1 research?

Several cutting-edge approaches could significantly enhance our understanding of DGK1:

  • Cryo-electron microscopy to determine the three-dimensional structure of DGK1 and its complexes

  • Lipidomics to comprehensively analyze changes in lipid profiles in response to DGK1 manipulation

  • Optogenetic approaches to achieve spatiotemporal control of DGK1 activity in living cells

  • CRISPR-based screening to identify novel genetic interactions with DGK1

  • Single-molecule imaging techniques to track DGK1 dynamics and interactions in real-time

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.