Recombinant Saccharomyces cerevisiae Cytochrome b5 (CYB5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its inclusion in the production process.
Synonyms
CYB5; YNL111C; N1949; Cytochrome b5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
CYB5
Target Protein Sequence
MPKVYSYQEVAEHNGPENFWIIIDDKVYDVSQFKDEHPGGDEIIMDLGGQDATESFVDIG HSDEALRLLKGLYIGDVDKTSERVSVEKVSTSENQSKGSGTLVVILAILMLGVAYYLLNE
Uniprot No.

Target Background

Function
Recombinant *Saccharomyces cerevisiae* Cytochrome b5 (CYB5) is a membrane-bound hemoprotein functioning as an electron carrier for various membrane-bound oxygenases. It plays a crucial role in fatty acid desaturation and several steps of sterol biosynthesis, notably the 4-demethylation of 4,4'-dimethyl zymosterol.
Database Links

KEGG: sce:YNL111C

STRING: 4932.YNL111C

Protein Families
Cytochrome b5 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein; Cytoplasmic side. Microsome membrane; Single-pass membrane protein; Cytoplasmic side.

Q&A

What is the basic structure of Cytochrome b5 in Saccharomyces cerevisiae?

Cytochrome b5 (CYB5) in S. cerevisiae is a small heme-binding protein with a highly conserved structure. It typically consists of:

  • A single transmembrane domain near its C-terminus that anchors it to the endoplasmic reticulum (ER) and/or outer mitochondrial membranes

  • A tail region that regulates intracellular localization

  • A large N-terminal domain exposed to the cytosol

  • A highly conserved heme-binding motif (-HPGG-) that is essential for its electron transfer function

The protein's structural organization enables it to function as a membrane-bound electron carrier, interacting with various partners in different metabolic pathways .

What are the primary functions of CYB5 in yeast cells?

In S. cerevisiae, Cytochrome b5 serves multiple vital functions:

  • Electron transfer: With a redox potential of approximately 20 mV, CYB5 accepts electrons from either NADH-dependent cytochrome b5 reductase (CBR) or NADPH-dependent cytochrome P450 reductase (CPR), then transfers these electrons to terminal acceptors

  • Metabolic regulation: Participates in anabolic metabolism of fatty acids and steroids

  • Xenobiotic metabolism: Contributes to the catabolism of xenobiotics and compounds of endogenous metabolism

  • Membrane homeostasis: May be involved in lipid metabolism and membrane composition maintenance

  • Protein-protein interactions: Forms functional complexes with various partners including cytochrome P450 enzymes

These diverse functions make CYB5 a critical component in cellular redox homeostasis and metabolic regulation .

How does the membrane-binding domain of CYB5 influence its function?

The membrane-binding domain of CYB5 is crucial for its proper localization and function:

  • Topology: The COOH-terminal membrane binding domain spans the ER membrane rather than forming a hairpin structure, as demonstrated by mutation studies

  • Critical regions: The distal part of the membrane binding domain (C-terminal 19 amino acids) is necessary for:

    • In vivo binding to the endoplasmic reticulum

    • Functioning with membrane-associated electron transfer partners

  • Membrane anchoring: Pro-115, located in the middle of the putative α-helical membrane-anchoring domain, was previously hypothesized to create either a hairpin-like loop or approximately 26° kink in the helix

  • Experimental evidence: Mutation studies (Pro-115→Ala) demonstrated that a straight transmembrane helix inserts normally into the ER and shows wild-type activity levels, suggesting the hairpin structure is not essential for function

These findings highlight the importance of proper membrane integration for CYB5's electron transfer capabilities and interactions with partner proteins .

What are the optimal conditions for heterologous expression of recombinant S. cerevisiae CYB5?

For successful expression of recombinant S. cerevisiae CYB5, researchers should consider:

Expression Systems:

  • S. cerevisiae itself serves as an excellent homologous expression system

  • Escherichia coli can efficiently express the soluble domain of CYB5 (as demonstrated with Fah1p CYB5 domain)

  • Other yeast strains like Pichia pastoris may offer advantages for higher protein yields

Key Parameters:

  • Vector selection: Use vectors with strong promoters appropriate for the expression system (GAL, ADH or TEF for yeast)

  • Induction conditions: For galactose-inducible promoters, determine optimal induction time and concentration

  • Growth temperature: Lower temperatures (16-25°C) often improve proper folding of heme-containing proteins

  • Heme supplementation: Addition of δ-aminolevulinic acid or hemin can increase holo-protein yields

  • Membrane vs. soluble forms: Express either full-length membrane-bound or truncated soluble forms depending on research needs

Construct Design:

  • Include appropriate tags (His, FLAG, etc.) for purification

  • Consider codon optimization for the expression host

  • For membrane-bound forms, ensure the C-terminal membrane-anchoring domain is intact

  • For soluble forms, remove the C-terminal membrane-anchoring domain

What purification strategies are most effective for obtaining functional recombinant CYB5?

Effective purification of recombinant CYB5 requires specific strategies depending on whether you're working with membrane-bound or soluble forms:

For Membrane-Bound CYB5:

  • Membrane isolation: Differential centrifugation to isolate microsomal fraction

  • Solubilization: Gentle detergents (CHAPS, Triton X-100, or digitonin) to extract membrane proteins

  • Affinity chromatography: If tagged, use appropriate affinity resin

  • Ion exchange chromatography: Further purification based on charge properties

  • Size exclusion chromatography: Final polishing step to remove aggregates

For Soluble CYB5 Domain:

  • Affinity chromatography: Primary capture step (His-tag or other fusion tags)

  • Ion exchange chromatography: Secondary purification

  • Size exclusion chromatography: Final purification step

  • Heme incorporation: Monitor spectroscopically for proper heme binding

Quality Control Metrics:

  • Spectroscopic analysis: Measure absorbance at 413 nm (oxidized) and 423 nm (reduced) to confirm proper heme incorporation

  • Purity assessment: SDS-PAGE and Western blotting

  • Functional assays: Electron transfer capability tests

  • Structural integrity: Circular dichroism spectroscopy

How can you verify proper folding and heme incorporation in recombinant CYB5?

Verification of proper folding and heme incorporation is critical for functional CYB5 studies:

Spectroscopic Analysis:

  • UV-visible spectroscopy: Properly folded CYB5 with incorporated heme exhibits characteristic absorbance peaks:

    • Oxidized form: Strong Soret band at approximately 413 nm

    • Reduced form: Shifted Soret band at approximately 423 nm

    • Additional α and β bands in the 520-560 nm region in the reduced form

  • Differential spectroscopy: Compare oxidized versus reduced spectra to confirm functional heme binding, as seen with Fah1p CYB5 domain expression

Functional Assays:

  • Reduction assay: Measure reduction by cytochrome b5 reductase using NADH

  • Cytochrome P450 coupling: Assess ability to transfer electrons to P450 enzymes

  • Quantification of heme incorporation ratio (heme:protein)

Structural Verification:

  • Circular dichroism: Evaluate secondary structure

  • Thermal stability assays: Well-folded proteins typically show cooperative unfolding

  • Size exclusion chromatography: Assess aggregation state

Enzymatic Activity:

  • In vitro reconstitution with partner proteins

  • Substrate conversion assays when coupled with appropriate enzymes

What strategies are most effective for disrupting the CYB5 gene in S. cerevisiae?

Several proven strategies exist for disrupting the CYB5 gene in S. cerevisiae:

PCR-based Gene Disruption:

  • Design primers containing 40-60 bp homology to CYB5 flanking regions and 20 bp complementary to a selectable marker gene

  • Amplify the selectable marker (such as ARG4, URA3, or KanMX)

  • Transform S. cerevisiae with the PCR product

  • Select transformants on appropriate media

  • Verify disruption by PCR using primers that anneal outside the integration site

Plasmid-based Disruption:

  • Construct a plasmid containing CYB5 flanking sequences surrounding a selectable marker

  • Linearize the plasmid within the homology region

  • Transform yeast and select for marker integration

  • Confirm proper integration by PCR or Southern blotting

CRISPR-Cas9 Method:

  • Design guide RNA targeting CYB5

  • Prepare repair template with homology arms and selectable marker

  • Co-transform guide RNA, Cas9 expression plasmid, and repair template

  • Select transformants and verify disruption

Verification Methods:

  • PCR confirmation: Design checking primers that amplify different sizes for wild-type and disrupted alleles

  • Phenotypic analysis: Assess growth characteristics and sterol profiles

  • Complementation: Reintroduce CYB5 under control of a regulated promoter to confirm phenotype is due to CYB5 disruption

What are the critical amino acid residues in CYB5 that affect its electron transfer function?

Several critical amino acid residues in CYB5 significantly impact its electron transfer function:

Heme-Binding Region:

  • The highly conserved HPGG motif is essential for proper heme binding

  • Histidine residues that coordinate the heme iron are absolutely critical

  • Mutations in these residues typically abolish electron transfer capability

Membrane-Anchoring Domain:

  • Pro-115: Located in the middle of the membrane-anchoring domain, mutation to alanine maintains function, indicating it's not critical for electron transfer but may influence membrane topology

  • C-terminal residues (approximately 19 amino acids): Essential for proper ER binding and interaction with electron transfer partners

  • Ser-104 to Met-125 region: Replacement with leucine residues results in reduced function (only 50% reduction compared to wild-type) and inability to support P450-mediated substrate oxidation

Protein Surface Residues:

  • Residues at the interaction interface with partner proteins (such as cytochrome P450 and cytochrome b5 reductase)

  • Charged residues that facilitate proper orientation and electron transfer

C-Terminal Flanking Residues:

  • Ala-131 and Glu-132: Flanking the transmembrane domain, mutation to lysines maintains normal membrane topology and function

Understanding these critical residues provides insights into structure-function relationships and guides rational protein engineering approaches.

How does disruption of the CYB5 gene affect sterol biosynthesis in yeast?

Disruption of the CYB5 gene in yeast has significant effects on sterol biosynthesis:

Altered Sterol Profile:

  • Reduced ergosterol levels: The primary sterol in wild-type yeast (normally >85% of total sterols) is significantly decreased in CYB5 mutants

  • Accumulation of sterol intermediates: CYB5-disrupted strains accumulate precursors in the ergosterol biosynthetic pathway

  • Similar phenotype across yeasts: Both S. cerevisiae and C. albicans CYB5 mutants show comparable alterations in sterol composition

Mechanism:

  • CYB5 provides electrons to sterol desaturases and other P450 enzymes involved in ergosterol biosynthesis

  • Without CYB5, these enzymes have reduced activity, leading to incomplete conversion of sterol intermediates to ergosterol

Experimental Evidence:

  • Comparative sterol analysis between wild-type and CYB5-disrupted strains shows distinctive differences in sterol profiles

  • When C. albicans CYB5 disruptant (KRC7) is grown on glucose (repressing condition for the wild-type CYB5 allele), it produces a sterol profile similar to that of the S. cerevisiae CYB5 mutant (Wb5Δ)

Physiological Implications:

  • Despite altered sterol composition, CYB5 is non-essential in both S. cerevisiae and C. albicans

  • Cells can survive with reduced ergosterol levels, though potentially with altered membrane properties and stress responses

  • The non-essentiality indicates compensatory mechanisms exist for electron provision to sterol-modifying enzymes

How can CYB5 be utilized to enhance the production of bioactive compounds in metabolic engineering?

CYB5 offers significant potential for enhancing bioactive compound production in metabolic engineering applications:

Improved P450 Enzyme Functionality:

  • CYB5 enhances electron transfer efficiency to P450 enzymes

  • Co-expression with cytochrome P450 enzymes and their reductases increases product yields

  • Reduces uncoupling reactions that generate reactive oxygen species

Demonstrated Applications:

  • Artemisinic acid production:

    • Integration of Artemisia annua CYB5 with CYP71AV1 and CPR1 significantly improved yields from 115 mg/L to 25 g/L

    • CYB5 improved coupling efficiency and reduced oxidative stress in engineered cells

  • Glycyrrhetinic acid (GA) production:

    • Addition of Glycyrrhiza uralensis CYB5 to a recombinant pathway containing CYP88D6 and CYP72A154 resulted in an eightfold enhancement of GA production

    • Further optimization with MVA pathway genes improved GA concentration by 40-fold during batch fermentation

Implementation Strategies:

  • Co-express CYB5 with target P450 enzymes and reductases

  • Optimize expression ratios between components

  • Consider fusion proteins linking CYB5 to P450s for improved electron transfer

  • Engineer CYB5 variants with enhanced stability or activity

Advantages:

  • Reduces oxidative stress in engineered cells

  • Improves yields of desired metabolites

  • Enhances efficiency of biocatalytic processes

  • May allow production of compounds otherwise limited by P450 activity

What methods are most effective for studying CYB5 interactions with partner proteins?

Several sophisticated methods are available for studying CYB5 interactions with partner proteins:

In Vitro Methods:

  • Co-purification assays:

    • Tandem affinity purification

    • Pull-down assays using tagged proteins

    • Size exclusion chromatography to identify complex formation

  • Biophysical techniques:

    • Surface plasmon resonance (SPR) for real-time interaction kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Microscale thermophoresis (MST) for quantitative interaction analysis

  • Functional assays:

    • Reconstituted systems with purified components

    • Spectroscopic monitoring of electron transfer

    • Activity assays measuring functional outcomes of interactions

In Vivo Methods:

  • Yeast two-hybrid system:

    • Modified for membrane proteins

    • Split-ubiquitin systems for membrane protein interactions

  • Fluorescence-based techniques:

    • Bimolecular fluorescence complementation (BiFC)

    • Förster resonance energy transfer (FRET)

    • Fluorescence lifetime imaging microscopy (FLIM)

  • Genetic approaches:

    • Synthetic genetic array analysis

    • Suppressor screens

    • Conditional expression systems to confirm functional interactions

Specific Example:
The interaction between MdCYB5 (apple cytochrome b5) and sugar transporters has been studied using:

  • Yeast two-hybrid assays showing that low sugar supply enhances interactions

  • In planta BiFC assays confirming protein-protein interactions

  • Functional assays demonstrating that co-expression promotes sugar uptake and reduces Km values of transporters, increasing their affinity for substrates

These methods provide complementary information about the physical and functional aspects of CYB5 interactions.

How do mutations in the membrane-anchoring domain affect CYB5 function and localization?

Mutations in the membrane-anchoring domain have profound effects on CYB5 function and localization:

Structural Impacts:

  • Pro-115 mutations:

    • Pro-115→Ala mutation (eliminating the potential helix kink) maintains normal insertion into the ER and exhibits wild-type activity levels

    • This indicates that a potential hairpin structure is not essential, and the membrane-binding domain likely spans the membrane in a more direct manner

  • Truncation effects:

    • Pro-115→Stop mutation (removing 19 C-terminal amino acids) disrupts proper ER binding

    • This truncated protein cannot function effectively with membrane-associated electron transfer partners

    • Demonstrates that the distal portion of the membrane domain is critical for both localization and function

  • Composition alterations:

    • Replacement of Ser-104 to Met-125 (the putative membrane-anchoring domain) with 22 leucine residues:

      • The protein still targets to the ER

      • Reduction level is only 50% compared to wild-type in yeast microsomes

      • Unable to support cytochrome P450-mediated substrate oxidation in vitro

      • Shows that specific sequence characteristics, not just hydrophobicity, are important

  • Charge modifications:

    • Mutation of Ala-131 and Glu-132 (amino acids flanking the transmembrane domain) to lysines results in normal membrane topology and function

    • Indicates tolerance for charge modifications at the membrane boundary regions

Functional Consequences:

  • Proper membrane anchoring is essential for:

    • Correct subcellular localization

    • Orientation relative to partner proteins

    • Electron transfer capacity

    • Integration into functional complexes

These findings highlight the importance of the membrane-anchoring domain beyond simple membrane association, suggesting it plays critical roles in orienting the protein for optimal interactions with partner proteins.

What role does CYB5 play in coordinating cellular redox status with metabolic pathways?

CYB5 serves as a crucial redox hub, coordinating cellular redox status with multiple metabolic pathways:

Integration with Sugar Metabolism:

  • CYB5 proteins physically interact with sugar transporters (e.g., MdSUT1, MdSOT6 in apple; AtSUT4 in Arabidopsis)

  • Low sugar conditions enhance these interactions

  • CYB5-transporter interactions increase transporter affinity for sugars, stimulating uptake

  • This mechanism helps maintain stable intracellular sugar levels during low external sugar availability

  • Sucrose specifically represses the interaction between AtSUT4 and AtCB5-E, indicating sugar-specific regulation

Coordination with Ethylene Signaling:

  • Arabidopsis CYB5s interact with RTE1 (REVERSION-TO-ETHYLENE SENSITIVITY1) protein

  • This interaction promotes ETR1-mediated repression of ethylene signaling

  • CYB5 likely activates RTE1 through redox modification

  • Provides a direct link between cellular redox status and hormone signaling

  • Double mutants of Arabidopsis CYB5 genes display ethylene hypersensitivity

  • Overexpression of AtCB5-D confers reduced ethylene sensitivity

Regulation of Lignin Biosynthesis:

  • AtCB5-D serves as an indispensable electron carrier in S-lignin biosynthesis

  • Functions as a regulatory/metabolic hub coordinating ethylene signaling and lignin synthesis

  • May regulate precision processes in cell wall modifications during organ abscission

  • Responds to cellular redox status to coordinate these processes

Metabolic Engineering Applications:

  • In artemisinic acid production, addition of CYB5 significantly reduced oxidative stress caused by poor coupling between P450 and reductase

  • Improved coupling efficiency reduces reactive oxygen species generation

  • Enhances desired product formation while reducing cellular stress

  • Demonstrates the role of CYB5 in balancing effective electron utilization versus ROS production

This multifaceted role positions CYB5 as a critical integration point between cellular redox state and diverse metabolic and signaling pathways.

How can structure-function analysis of CYB5 inform rational design of optimized variants for biotechnology?

Structure-function analysis of CYB5 provides crucial insights for rational protein engineering:

Key Structure-Function Relationships:

Structural FeatureFunctional RoleEngineering Potential
Heme-binding domainElectron acceptance/donationModify redox potential for specific applications
Surface residuesPartner protein interactionsEngineer interface for enhanced coupling
Membrane-anchoring domainSubcellular localizationOptimize for specific membrane environments
Linker regionsConformational flexibilityAdjust for optimal interaction with diverse partners
Pro-115 in transmembrane regionMembrane topologyModify for altered membrane integration

Rational Design Strategies:

  • Redox potential optimization:

    • Mutations near the heme group can alter redox potential

    • Tailored variants can be created for specific electron transfer partners

    • Fine-tuning electron transfer efficiency for specific applications

  • Interaction interface engineering:

    • Targeted mutations at protein-protein interfaces can enhance specific interactions

    • Creating variants with higher affinity for specific P450 enzymes

    • Developing variants with broader partner compatibility

  • Stability enhancement:

    • Identifying and modifying regions prone to degradation

    • Engineering disulfide bonds or salt bridges for increased stability

    • Optimizing for expression in heterologous systems

  • Domain shuffling and fusion proteins:

    • Creating chimeric proteins with domains from different CB5 variants

    • Developing direct fusion proteins with partner enzymes for enhanced electron transfer

    • Combining functional domains for novel activities

These rational design approaches can lead to CYB5 variants with enhanced performance in specific biotechnological applications.

What experimental approaches can resolve contradictory findings about CYB5 membrane topology?

Resolving contradictory findings about CYB5 membrane topology requires multiple complementary approaches:

Integrated Experimental Strategy:

  • Advanced structural biology techniques:

    • Cryo-electron microscopy of membrane-embedded CYB5

    • Solid-state NMR spectroscopy to analyze membrane protein structure

    • EPR spectroscopy with site-directed spin labeling to map membrane boundaries

  • Comprehensive mutagenesis approaches:

    • Systematic cysteine scanning mutagenesis with accessibility assays

    • Glycosylation mapping using engineered glycosylation sites

    • Proline scanning to identify regions tolerant of helix-disrupting residues

  • Topology mapping methods:

    • Protease protection assays with mass spectrometry analysis

    • Fluorescence quenching experiments with membrane-impermeable quenchers

    • FRET-based distance measurements between labeled residues

  • Computational integration:

    • Molecular dynamics simulations of membrane integration

    • Integration of experimental constraints into structural models

    • Prediction of energetically favorable topologies

Specific Experimental Design to Resolve Hairpin vs. Spanning Models:

ApproachMethodologyExpected Outcome for HairpinExpected Outcome for Spanning
Cysteine accessibilityLabel with membrane-impermeable reagentsCysteines in loop accessibleOnly cysteines on one side accessible
Proline effectsIntroduce prolines at various positionsCritical at bend positionsDistributed effects along helix
Distance measurementsFRET between labeled residuesShort distances between predicted endsLonger distances consistent with span
Glycosylation mappingInsert glycosylation sitesSites in loop glycosylatedOnly sites on one side glycosylated

The Pro-115→Ala mutation study already suggests the spanning model is more likely since this mutation, which would eliminate a potential hairpin-inducing kink, maintained normal function . Additional experimental approaches would provide further confirmation and detailed mapping of the topology.

How does the interplay between CYB5 and partner proteins contribute to metabolic flexibility in yeast?

The interplay between CYB5 and its partner proteins creates a sophisticated network contributing to metabolic flexibility in yeast:

Regulatory Mechanisms:

  • Dynamic partner selection:

    • CYB5 interacts with multiple partner proteins with varying affinities

    • Partner selection can shift based on metabolic conditions

    • Creates a system that can redirect electron flow based on cellular needs

  • Redox sensing and signaling:

    • CYB5 serves as both an electron carrier and potential redox sensor

    • Interactions with partners like sugar transporters are influenced by carbon source availability

    • Forms a feedback loop where metabolic state influences transport activity through CYB5-mediated interactions

  • Conditional complex formation:

    • Different metabolic conditions promote formation of specific protein complexes

    • Low sugar enhances CYB5-sugar transporter interactions

    • May facilitate rapid metabolic switching in response to environmental changes

Metabolic Integration Points:

Metabolic PathwayCYB5 RolePartner ProteinsRegulatory Outcome
Lipid metabolismElectron donorFatty acid desaturases, elongasesMembrane lipid composition adjustment
Sterol biosynthesisElectron donorSterol desaturases, P450 enzymesAltered ergosterol production
Carbon transportAllosteric regulatorSugar transportersEnhanced sugar uptake during limitation
Xenobiotic metabolismElectron donorCytochrome P450sDetoxification capacity
Hormone signalingRedox modifierSignaling proteins (e.g., RTE1)Coordination with ethylene response

Evolutionary Perspective:

  • The central position of CYB5 in multiple pathways suggests it evolved as a metabolic hub

  • Functional redundancy in some pathways (as seen in Arabidopsis CB5s) provides robustness

  • The non-essentiality of CYB5 in yeast indicates alternative electron transfer mechanisms exist

  • This redundancy enhances metabolic flexibility and stress resilience

This sophisticated interplay positions CYB5 as a critical component in yeast's ability to adapt to changing nutrient availability and environmental conditions.

What is the significance of CYB5 fusion proteins like Fah1p in understanding functional evolution?

CYB5 fusion proteins like Fah1p provide valuable insights into functional evolution:

Evolutionary Significance:

  • Domain architecture and functional innovation:

    • Fah1p contains an N-terminal cytochrome b5 domain fused to additional functional domains

    • Shows 52% identity and 70% similarity to yeast microsomal cytochrome b5 core domain

    • Also shares 35% identity and 54% similarity with the b5 domain of OLE1 (Δ-9 fatty acid desaturase)

    • Represents an evolutionary innovation through domain fusion

  • Functional diversification:

    • Fah1p likely evolved from gene duplication followed by domain acquisition

    • Maintained electron transfer capability while gaining new catalytic functions

    • Shares similarities with Ole1p, including two hydrophobic domains and characteristic HX(2-3)(XH)H motifs of membrane-bound fatty acid desaturases

    • Demonstrates how electron transfer domains can be recruited for new metabolic roles

  • Comparative genomics insights:

    • Identified through genomic database searching for CYB5-like sequences

    • Located on chromosome XIII at locus YMR272C

    • Encodes a 384-amino acid protein compared to typical CYB5 proteins (~130 amino acids)

    • Suggests selective advantage for maintaining this fusion protein in yeast

Research Applications:

  • Model for studying protein evolution:

    • Natural experiment in domain shuffling and acquisition

    • Provides insights into mechanisms of new enzyme generation

    • Demonstrates functional integration of electron transfer and catalytic domains

  • Biotechnological template:

    • Inspiration for engineered fusion proteins

    • Potential for creating synthetic enzymes with self-contained electron transfer capabilities

    • Guide for optimizing electron delivery to catalytic domains

  • Metabolic pathway evolution:

    • Suggests mechanisms for evolution of new metabolic pathways

    • Indicates how electron transfer components can be integrated into new functions

    • May inform understanding of fatty acid modification pathway evolution

The study of Fah1p and similar fusion proteins provides a window into evolutionary processes that generate novel protein functions while maintaining core capabilities, offering insights for both fundamental evolutionary biology and applied protein engineering.

How might CYB5 function in coordinating redox state with stress responses in yeast?

Recent research suggests CYB5 plays a significant role in linking cellular redox state with stress response mechanisms:

Redox Homeostasis and Stress Coordination:

  • Oxidative stress response:

    • CYB5 may help maintain redox balance during oxidative stress

    • Functions in systems that prevent/repair oxidative damage

    • Electron transfer activity could directly neutralize reactive oxygen species

    • Disruption of CYB5 may alter cellular resistance to oxidative stressors

  • Membrane integrity regulation:

    • CYB5's role in sterol and lipid metabolism affects membrane composition

    • Altered sterol profiles in CYB5 mutants likely affect membrane properties

    • Membrane composition changes influence resistance to various stresses (temperature, osmotic, etc.)

    • May serve as a mechanism to adjust membrane properties in response to stress

  • Integration with signaling pathways:

    • Evidence from plant systems shows CYB5 modulates ethylene signaling responses

    • Similar coordination may exist in yeast with stress-response signaling

    • Potential involvement in nutrient sensing pathways through interactions with transporters

    • May serve as a metabolic checkpoint linking redox state to stress response activation

Research Approaches to Investigate This Connection:

Investigation AreaExperimental ApproachExpected Outcomes
Stress tolerance profilingSubject CYB5 mutants to diverse stressorsIdentify specific stress sensitivities
Redox proteomicsAnalyze protein oxidation state changesMap redox-sensitive proteins affected by CYB5
Transcriptomics/metabolomicsCompare wild-type and mutant responses to stressIdentify pathways regulated by CYB5 during stress
Interactome analysisStress-dependent protein interaction mappingDiscover stress-specific CYB5 interaction partners

These emerging research directions may reveal CYB5 as a critical component in coordinating redox homeostasis with appropriate stress responses, potentially uncovering novel therapeutic targets or biotechnological applications.

What are the implications of CYB5 research for understanding and treating fungal pathogen resistance?

CYB5 research has significant implications for understanding and addressing fungal pathogen resistance:

Antifungal Resistance Mechanisms:

  • Sterol biosynthesis pathway modulation:

    • CYB5 contributes to ergosterol biosynthesis, the target of many antifungals

    • Altered sterol composition in CYB5 mutants may affect susceptibility to sterol-targeting drugs

    • CYB5-dependent modifications of the sterol biosynthetic pathway could represent adaptation mechanisms to antifungal pressure

  • Membrane composition effects:

    • Changes in membrane lipid and sterol composition affect drug uptake and efficacy

    • CYB5's role in lipid metabolism influences membrane permeability and fluidity

    • May contribute to exclusion of antifungal compounds from cells

  • Xenobiotic metabolism:

    • CYB5 provides electrons to P450 enzymes involved in drug metabolism

    • Could contribute to detoxification of antifungal compounds

    • Variations in CYB5 expression or function may influence drug detoxification capacity

Therapeutic Potential:

Research on CYB5 in pathogenic fungi like C. albicans, combined with insights from S. cerevisiae, could lead to novel approaches for addressing the growing problem of antifungal resistance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.