Recombinant Saccharomyces cerevisiae Cytochrome c oxidase subunit 2 (COX2)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Saccharomyces cerevisiae Cytochrome c Oxidase Subunit 2 (COX2)

Cytochrome c oxidase subunit 2 (COX2) is a mitochondrial-encoded core component of Complex IV in the electron transport chain, responsible for reducing molecular oxygen to water during oxidative phosphorylation. In Saccharomyces cerevisiae, recombinant COX2 is expressed as a precursor protein requiring post-translational modifications, membrane insertion, and copper metallation for functional integration into the holoenzyme .

Primary Structure

  • Molecular weight: ~25 kDa (unprocessed precursor) .

  • Domains:

    • N-terminal mitochondrial targeting sequence (cleaved after membrane insertion) .

    • Two transmembrane helices anchoring the protein to the inner mitochondrial membrane.

    • C-terminal Cu<sub>A</sub> center-binding domain critical for electron transfer .

Copper Metallation

COX2 harbors a binuclear Cu<sub>A</sub> center, which requires a conserved copper relay system for maturation:

Copper ChaperoneRole in Cu<sub>A</sub> FormationKey Interactions
SCO1Direct copper transfer to COX2COX16, COX2
SCO2Regulates copper effluxCOX17
COA6Stabilizes COX2-SCO1 interactionCOX2
COX16Scaffold for Cu<sub>A</sub> metallationSCO1, COX2

Mitochondrial Translation and Processing

  • COX2 is synthesized in the mitochondrial matrix as a precursor (pre-COX2) with an N-terminal leader peptide .

  • Key steps:

    1. Membrane insertion: Mediated by OXA1L and COX18 translocases .

    2. Leader peptide cleavage: Performed by the inner membrane protease, chaperoned by COX20 .

    3. C-tail export: Post-translational translocation via COX18 and COX20 .

Assembly Intermediates

COX2 assembles as a stand-alone module before merging with COX1/COX3-containing intermediates :

Intermediate Size (kDa)Associated FactorsFunction
450–550COX18, COX20Membrane insertion and C-tail export
250–350SCO1, COA6Cu<sub>A</sub> metallation

Genetic Dependencies

  • ΔDMO2 mutants exhibit reduced COX activity due to impaired COX2 turnover .

  • ΔCOX16 disrupts SCO1-COX2 binding, blocking Cu<sub>A</sub> site formation .

  • ΔCOX20 abolishes leader peptide processing and C-tail export .

Stress Response

  • dmo2Δ mutants show thermosensitivity (37°C) and oxidative stress susceptibility .

  • Overexpression of DMO2 rescues copper homeostasis defects in cox23Δ mutants .

Key Research Findings

  1. COX2 stability depends on interactions with COX20 and COX18 during biogenesis .

  2. Copper relay defects (e.g., SCO1 mutations) impair COX2 maturation, causing respiratory deficiency .

  3. Modular assembly: COX2 forms independent intermediates (~550 kDa) before merging with COX1 modules .

Open Questions and Research Gaps

  • Structural details of COX2-SCO1-COX16 ternary complexes remain unresolved .

  • Mechanisms spatiotemporally separating SCO1 and SCO2 roles in Cu<sub>A</sub> metallation require further study .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
COX2; OXI1; Q0250; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
16-251
Protein Length
Full Length of Mature Protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
COX2
Target Protein Sequence
DVPTPYACYFQDSATPNQEGILELHDNIMFYLLVILGLVSWMLYTIVMTYSKNPIAYKYI KHGQTIEVIWTIFPAVILLIIAFPSFILLYLCDEVISPAMTIKAIGYQWYWKYEYSDFIN DSGETVEFESYVIPDELLEEGQLRLLDTDTSMVVPVDTHIRFVVTAADVIHDFAIPSLGI KVDATPGRLNQVSALIQREGVFYGACSELCGTGHANMPIKIEAVSLPKFLEWLNEQ
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (COX2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that drives ATP synthesis. COX2 plays a crucial catalytic role, transferring electrons from cytochrome c via its dinuclear copper A center (CuA) to the binuclear center (BNC) within COX1. This BNC, composed of heme a3 and copper B (CuB), catalyzes the reduction of molecular oxygen to water, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.
Gene References Into Functions
  1. The cytosolically synthesized subunit II (Cox2) precursor with the W56R point mutation is correctly processed in yeast mitochondria, rescuing cytochrome oxidase activity. PMID: 22985601
  2. A single mutation in the first Cox2 transmembrane domain yields a Cox2 variant with a molecular mass indicating cleavage of mitochondrial targeting sequences. PMID: 20194738
  3. Immunoblot analysis of wild-type and Cox2p mutant yeast revealed five cytochrome oxidase complexes or subcomplexes: a, b, c, d, and f. PMID: 15921494
  4. The C-terminal domain is post-translationally recognized by a specialized translocation apparatus after N-terminal translocation by Oxa1. PMID: 17452441
  5. Yme1 likely chaperones the folding and/or assembly of Oxa1-exported Cox2 in the absence of Mrg1 or Mgr3, as respiratory growth and cytochrome c oxidase assembly in a cox18 mgr3 double-mutant strain overexpressing OXA1 are YME1-dependent. PMID: 19307606
Database Links

KEGG: sce:Q0250

STRING: 4932.Q0250

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the localization and topology of Cox2p in Saccharomyces cerevisiae?

    Cox2p is localized in the mitochondrial inner membrane with its conserved cysteines in a Cx2C motif facing the intermembrane space . This topological arrangement is critical for proper function in electron transfer. The protein contains transmembrane domains that anchor it to the membrane while positioning its functional domains correctly for interaction with other proteins and cofactors. The orientation with conserved cysteines in the intermembrane space is particularly important as it allows for proper copper incorporation and interaction with copper chaperones. To study Cox2p localization, researchers typically employ subcellular fractionation, immunofluorescence microscopy with tagged variants, and protease protection assays to determine membrane orientation and topology.

  • What are the main functions of Cox2p in yeast cytochrome c oxidase?

    Cox2p serves several critical functions in the cytochrome c oxidase (COX) complex of S. cerevisiae. Its primary role is harboring the binuclear CuA center, which receives electrons from cytochrome c and transfers them to the catalytic center in Cox1p . This electron transfer is essential for the reduction of molecular oxygen to water, coupled with proton translocation across the inner membrane. Cox2p also contributes to the structural integrity of the entire COX complex and influences the formation of respiratory supercomplexes . Research has demonstrated that Cox2p is absolutely essential for COX activity, as the enzyme does not assemble properly in the absence of functional Cox2p . The copper centers in Cox2p are particularly important for its electron transfer function, making proper metalation a critical aspect of Cox2p maturation.

  • How is Cox2p processed and inserted into the mitochondrial membrane?

    The maturation and membrane insertion of Cox2p involve a coordinated process requiring specialized proteins. Cox2p is initially synthesized as a precursor with an N-terminal leader sequence. Cox18p and Cox20p play crucial roles in processing and membrane insertion of the Cox2p precursor . Cox20p functions as a chaperone for newly synthesized Cox2p, protecting it from degradation and facilitating its maturation . Cox18p is specifically involved in the export of the C-terminal domain of Cox2p across the inner membrane.

    The experimental approach to study Cox2p processing typically involves pulse-chase labeling of mitochondrial translation products, analysis of precursor processing in wildtype and mutant strains, and co-immunoprecipitation studies to identify interacting partners. Research has shown that in the absence of these processing factors, Cox2p fails to mature properly, leading to respiratory deficiencies. The double mutant cox20 dmo2 shows a reduced frequency of reversion to respiratory competency compared to the single cox20 mutant, indicating the importance of both factors in Cox2p processing .

  • What key structural features of Cox2p are essential for its function?

    Several structural elements in Cox2p are critical for its proper function:

    Structural FeatureFunctionResearch Method
    Cx2C motifCopper coordination and redox activitySite-directed mutagenesis; functional assays
    Transmembrane helicesMembrane anchoring and complex stabilityHydrophobicity analysis; topology mapping
    CuA binding domainElectron reception from cytochrome cMetal binding assays; spectroscopy
    Intermembrane space domainInteraction with cytochrome cCrosslinking; co-immunoprecipitation

    The conserved cysteines in Cox2p are particularly important, as demonstrated by studies on similar motifs in interacting proteins where mutation of cysteine residues results in respiratory deficiency . These cysteines are likely involved in copper coordination and electron transfer functions. The proper folding and orientation of Cox2p's domains are essential for positioning the CuA center correctly for electron reception from cytochrome c and subsequent transfer to other components of the respiratory chain.

  • How can researchers express and purify recombinant Cox2p for functional studies?

    Expression and purification of recombinant Cox2p for functional studies involves specialized techniques due to its membrane localization and mitochondrial encoding. Research has successfully employed genetic modification approaches where COX2 is fused to tags such as hemagglutinin (HA) or tandem HA followed by protein C tag (HAC) . These tagged versions are then expressed by substituting the fusion genes (COX2-HA and COX2-HAC) for the cox2 null allele in S. cerevisiae .

    For purification, affinity chromatography using antibody beads specific to the protein tag has proven effective . Mitochondria from cells expressing the tagged Cox2p are typically extracted with detergents like lauryl maltoside and purified on protein C antibody beads. The purity and identity of the isolated protein can be verified by SDS-PAGE, silver staining, and Western blotting . Importantly, research has shown that tagged versions of Cox2p retain functionality, although the HAC tag reduces COX assembly and activity by approximately 20% . This relatively minor impairment still makes tagged Cox2p suitable for most functional studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.