Recombinant Saccharomyces cerevisiae Cytochrome c oxidase subunit 3 (COX3)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Tagging

Recombinant COX3 is typically expressed in E. coli with engineered tags for purification and functional studies.

Tagging Strategies

  • N-terminal His-tag: Fused to the protein for affinity chromatography (e.g., nickel-nitrilotriacetic acid columns) .

  • HAC-tag (Protein C + HA epitope): Used for coimmunoprecipitation studies to track assembly intermediates .

Tag TypeApplicationImpact on FunctionSource
C-terminal HisPurification via Ni-NTA columnsNo significant growth defect in yeast
N-terminal HACImmunoprecipitation of COX3 complexesPartial growth defect; reduced COX activity

Assembly Modules and Interactions

COX3 is part of a dedicated assembly module that coordinates with Cox1p and Cox2p modules to form the COX holoenzyme .

COX3-Associated Subunits

  • Nuclear-encoded subunits: Cox4p, Cox7p, Cox13p .

  • Assembly factors: Rcf1p (required for early assembly) and Rcf2p (involved in late-stage stabilization) .

Key Assembly Intermediates

  1. C1–C3 Complexes:

    • C2 (∼200 kDa): Contains Cox3p, Cox4p, Cox7p, Cox13p, and Rcf1p .

    • C3 (∼230 kDa): Larger intermediate with additional subunits or assembly factors .

  2. Supercomplexes: COX3p is incorporated into respirasomes (bc1 complex + COX) in 2:2 or 2:1 ratios .

IntermediateComponentsFunctionSource
C2Cox3p, Cox4p, Cox7p, Cox13p, Rcf1pEarly assembly platform
C3Expanded C2 with additional subunitsTransition to holoenzyme formation
SupercomplexCOX + bc1 complex (2:2 or 2:1 ratio)Stabilized respiratory chain activity

Assembly Dynamics

  • Rcf1p’s Role: Binds electrostatically to Cox3p (e.g., Asp254 in Cox3p and Arg143/Gln147 in Rcf1p’s QRRQ motif) to protect charged membrane surfaces during assembly .

  • Rcf2p’s Role: Replaces Rcf1p in mature COX, maintaining lipid interactions and stabilizing the enzyme .

Translational Regulation

  • mRNA-specific activators: Pet54p, Pet122p, and Pet494p coordinate COX3 mRNA translation with Cox1p and Cox2p synthesis via interactions on the inner mitochondrial membrane .

Functional Modulation

  • Rcf1p Enhances Activity: Modulates Cox1p’s catalytic environment, increasing COX efficiency under energy stress .

  • Rcf2p Reduces Activity: Competes with Rcf1p, dampening COX function in energy-sufficient conditions .

Applications and Biotechnological Relevance

  1. Structural Studies: Recombinant COX3 aids in cryo-EM and crystallographic analyses of COX architecture .

  2. Assembly Research: Tagged COX3 (e.g., HAC) tracks assembly intermediates and supercomplex formation .

  3. Therapeutic Targets: Insights into COX3-Rcf interactions inform strategies for mitochondrial disorders linked to COX dysfunction .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice shipment is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, centrifuge the vial briefly prior to opening to ensure the contents settle to the bottom. Recombinant Saccharomyces cerevisiae Cytochrome c oxidase subunit 3 (COX3) should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
COX3; OXI2; Q0275; Cytochrome c oxidase subunit 3; Cytochrome c oxidase polypeptide III
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
COX3
Target Protein Sequence
MTHLERSRHQQHPFHMVMPSPWPIVVSFALLSLALSTALTMHGYIGNMNMVYLALFVLLT SSILWFRDIVAEATYLGDHTMAVRKGINLGFLMFVLSEVLIFAGLFWAYFHSAMSPDVTL GACWPPVGIEAVQPTELPLLNTIILLSSGATVTYSHHALIAGNRNKALSGLLITFWLIVI FVTCQYIEYTNAAFTISDGVYGSVFYAGTGLHFLHMVMLAAMLGVNYWRMRNYHLTAGHH VGYETTIIYTHVLDVIWLFLYVVFYWWGV
Uniprot No.

Target Background

Function
Recombinant Saccharomyces cerevisiae Cytochrome c oxidase subunit 3 (COX3) is a component of cytochrome c oxidase, the terminal enzyme in the mitochondrial electron transport chain responsible for driving oxidative phosphorylation. The respiratory chain comprises three multisubunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes collaborate to transfer electrons derived from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient powers transmembrane transport and the ATP synthase. Cytochrome c oxidase specifically catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred through the dinuclear copper A center (CU(A)) of COX2 and heme A of COX1 to the active site within COX1. This active site is a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to two water molecules using four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix. COX3 serves as a catalytic core subunit.
Database Links

KEGG: sce:Q0275

STRING: 4932.Q0275

Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the role of Cytochrome c oxidase subunit 3 (COX3) in Saccharomyces cerevisiae?

Cytochrome c oxidase (Complex IV) in S. cerevisiae is a crucial component of the mitochondrial respiratory chain, with COX3 being one of the three core subunits encoded by mitochondrial DNA. While COX1 serves as the primary scaffold for assembly of the complex, COX3 plays essential roles in complex stability and proton pumping efficiency. The yeast mitochondrial cytochrome c oxidase contains eleven subunits total, with COX3 being critical for proper assembly and function of the complex . Unlike mammalian systems, yeast provides an excellent model for studying COX3 function due to the relative ease of mitochondrial genome manipulation and the viability of respiratory-deficient mutants on fermentable media.

How does the structure of yeast COX3 differ from its mammalian counterparts?

Yeast COX3 maintains significant structural homology with mammalian versions but contains important differences that influence its function. Based on homology modeling with bovine counterparts, yeast COX3 shows conservation in transmembrane helical domains but differs in several loop regions and specific amino acid residues at functional interfaces . These structural differences affect interactions with other subunits and potentially influence proton channel formation. While the core catalytic domains remain conserved across species, the regulatory and assembly interfaces show species-specific adaptations. These structural variations must be considered when designing experiments to study COX3 function or when using yeast as a model for human mitochondrial diseases.

What are the characteristics of COX3 mutants in yeast and how do they manifest phenotypically?

COX3 mutants in S. cerevisiae typically manifest as respiratory-deficient phenotypes, often appearing as "petite" colonies on solid media due to their inability to perform efficient aerobic respiration . These petite variants arise from mutations that disrupt mitochondrial function, with COX3 mutants specifically affecting cytochrome c oxidase assembly or activity. Biochemical assays reveal that COX3 mutants show:

Phenotypic CharacteristicWild-typeCOX3 Mutant
Colony size on YPDLargeSmall (petite)
Oxygen consumption rateHighReduced/Absent
Growth on non-fermentable carbonNormalPoor/Absent
Cytochrome spectra peaksNormalAltered/Absent
ROS productionLowElevated

Molecular analysis typically reveals deletions or point mutations in mitochondrial DNA, which can be detected through PCR analysis targeting the COX3 region . These mutants provide valuable models for studying respiratory chain assembly, mitochondrial gene expression regulation, and cellular adaptation to respiratory deficiency.

What are the most effective methods for introducing site-directed mutations into the COX3 gene in Saccharomyces cerevisiae?

Introducing site-directed mutations into COX3 presents unique challenges as it is encoded by the mitochondrial genome rather than nuclear DNA. Two primary approaches have proven effective:

  • Biolistic transformation method: This technique involves coating microprojectiles with DNA constructs containing desired COX3 mutations and mitochondrial selectable markers, then "shooting" them into yeast cells. Selection is performed on non-fermentable media to identify respiratory-competent transformants .

  • Mitochondrial transformation via homologous recombination: This approach leverages PCR-generated fragments with approximately 50 bp homology flanking the target COX3 region. The procedure typically involves:

    • PCR amplification of mutated COX3 with flanking sequences

    • Transformation into respiratory-deficient recipient strains

    • Selection of respiratory-competent revertants

    • Confirmation via sequencing of mitochondrial DNA

The selection of appropriate respiratory-deficient recipient strains is crucial for the success of these experiments. Strains with mitochondrial markers adjacent to COX3 facilitate easier selection and screening of transformants . Success rates are typically lower than nuclear transformations, often necessitating larger culture volumes and more extensive screening.

How can researchers effectively express and isolate recombinant COX3 for functional studies?

Expressing and isolating functional recombinant COX3 presents significant challenges due to its hydrophobic nature, mitochondrial encoding, and requirement for proper assembly within the cytochrome c oxidase complex. The most successful approach involves:

  • Integration-based expression: Rather than episomal expression, genomic integration ensures stable expression through multiple generations . The URA3 blaster cassette method allows sequential integrations with marker recycling for multiple manipulations .

  • Tagged COX3 constructs: Incorporating epitope tags or fluorescent proteins must be done cautiously as they may disrupt function. C-terminal tagging is generally more successful than N-terminal modifications.

  • Isolation protocol:

    • Mitochondrial isolation via differential centrifugation

    • Solubilization of mitochondrial membranes with appropriate detergents (typically dodecyl maltoside)

    • Affinity purification if tags are present, or immunoprecipitation with COX3-specific antibodies

    • Blue native PAGE to evaluate complex integrity

For functional studies, it's often more effective to isolate the entire cytochrome c oxidase complex rather than COX3 alone, as the isolated subunit may not maintain proper structure or function outside the complex.

What PCR-based approaches are most reliable for analyzing mutations in mitochondrial DNA affecting COX3?

PCR-based approaches for analyzing COX3 mutations must account for the unique challenges of mitochondrial DNA, including heteroplasmy (mixed populations of mutant and wild-type mtDNA) and the AT-rich nature of yeast mitochondrial DNA. The most reliable methods include:

  • Allele-specific PCR: Primers designed with 3' ends matching specific mutations allow selective amplification of mutant or wild-type sequences. This approach can detect known mutations with high sensitivity.

  • Real-time qPCR for heteroplasmy analysis: This quantifies the ratio of mutant to wild-type mitochondrial DNA copies, critical for understanding mutation penetrance and phenotypic effects .

  • Long-range PCR: Essential for detecting larger deletions or rearrangements that may affect COX3 and surrounding regions .

  • PCR followed by restriction fragment length polymorphism (RFLP) analysis: If mutations create or destroy restriction sites, RFLP can provide a simple screening method.

PCR ApproachSensitivityAdvantagesLimitations
Allele-specific PCRHigh for known mutationsSimple, fastRequires prior knowledge of mutation
Real-time qPCRQuantitative (>1%)Quantifies heteroplasmyRequires specialized equipment
Long-range PCRModerateDetects large deletionsLess efficient for point mutations
PCR-RFLPModerate (~5-10%)Simple screeningLimited to mutations affecting restriction sites

For comprehensive mutation analysis, sequencing of PCR products remains the gold standard, ideally using high-fidelity polymerases to minimize errors during amplification .

How can COX3 mutations be leveraged to understand mitochondrial disease mechanisms?

COX3 mutations in S. cerevisiae serve as valuable models for understanding human mitochondrial diseases associated with Complex IV deficiencies. The approach typically involves:

  • Homologous mutation modeling: Introducing mutations into yeast COX3 that correspond to pathogenic human mutations to assess functional impacts. This requires careful sequence alignment and structural comparison between yeast and human proteins .

  • Suppressor screening: Following introduction of pathogenic mutations, researchers can screen for second-site suppressors that restore function, providing insights into compensatory mechanisms and potential therapeutic targets .

  • Metabolic profiling: Comprehensive analysis of metabolic changes in COX3 mutants reveals adaptive responses that may be relevant to disease progression. This typically includes measurements of:

    • Reactive oxygen species production

    • ATP synthesis capacity

    • Alternative respiratory pathways activation

    • Metabolic shifts toward fermentation

Importantly, while yeast COX3 models provide valuable information, researchers must account for differences in respiratory chain organization, tissue-specific factors, and compensatory mechanisms when extrapolating to human disease. Parallel studies in human cell lines or patient-derived samples are recommended to validate findings from yeast models.

How do you resolve conflicting data when analyzing the effects of COX3 mutations on respiratory function?

When confronted with contradictory findings regarding COX3 mutations and respiratory function, researchers should implement a systematic approach to resolution:

  • Strain background verification: Confirm the genetic background of all strains, as background mutations can significantly influence phenotypes. This includes sequencing of relevant nuclear genes that interact with mitochondrial components .

  • Heteroplasmy assessment: Quantify the proportion of mutant versus wild-type mitochondrial DNA, as varying levels can produce inconsistent phenotypes. Use real-time qPCR to determine heteroplasmy levels across experimental conditions .

  • Methodological triangulation: Apply multiple independent techniques to measure respiratory function:

    • Oxygen consumption measurements

    • Growth on non-fermentable carbon sources

    • Complex IV activity assays

    • Mitochondrial membrane potential assessments

  • Environmental variable control: Systematically control for variables that influence respiratory phenotypes:

    • Growth phase

    • Media composition

    • Temperature

    • Oxygen availability

    • Cell density

When presenting conflicting data, explicitly acknowledge discrepancies and propose testable hypotheses to explain them. This transparent approach strengthens scientific rigor and may reveal unexpected biological complexity in COX3 function .

What are the cutting-edge approaches for studying COX3 assembly dynamics in real-time?

Recent technological advances have enabled more sophisticated analysis of COX3 assembly into the cytochrome c oxidase complex in real-time:

  • Import tracking with fluorescent reporter fusions: By creating COX3 constructs with photoactivatable fluorescent proteins, researchers can visualize import and assembly dynamics in living cells using high-resolution microscopy.

  • Pulse-chase experiments with stable isotope labeling: This approach enables quantitative tracking of newly synthesized COX3 through the assembly process:

    • Cells are pulse-labeled with heavy amino acids

    • Samples are collected at various time points

    • Complex IV is isolated via immunoprecipitation

    • Mass spectrometry identifies labeled components and their assembly kinetics

  • Proximity labeling techniques: BioID or APEX2 fusions to COX3 or assembly factors enable identification of transient interaction partners during the assembly process. This has revealed previously unknown assembly intermediates and regulatory factors.

  • Cryo-electron microscopy: While challenging due to membrane protein nature, recent advances in cryo-EM have enabled visualization of assembly intermediates at near-atomic resolution, providing structural insights into the assembly process.

These techniques have revealed that COX3 assembly involves coordinated interactions with multiple chaperones and assembly factors, with distinct assembly pathways under different metabolic conditions. This dynamic understanding has replaced earlier static models of complex assembly.

What strategies can overcome the challenges of low transformation efficiency when introducing recombinant COX3 into mitochondria?

Mitochondrial transformation in S. cerevisiae faces inherently low efficiency compared to nuclear transformation. Several strategies can significantly improve outcomes:

  • Optimized recipient strain selection: Use strains with mitochondrial markers adjacent to the COX3 locus to facilitate selection. Strains with specific "synthetic" respiratory deficiencies that can be complemented by successful transformation show higher identification rates .

  • Biolistic optimization:

    • Microparticle selection: Gold particles (0.6 μm) typically perform better than tungsten

    • DNA coating: Spermidine/CaCl₂ protocols yield more consistent results

    • Pressure settings: Optimization for each device is crucial (typically 1100-1350 psi)

    • Target distance: Adjust based on instrument specifications (usually 6-8 cm)

  • Homology length manipulation: While 50bp homology regions are sufficient for nuclear transformation, mitochondrial transformation benefits from extended homology regions (500-1000bp) .

  • Post-transformation selection strategies:

    • Initial plating on fermentable media followed by replica plating to non-fermentable media

    • Extended incubation times (5-7 days versus standard 2-3 days)

    • Reduced incubation temperature (25°C instead of 30°C)

Transformation MethodTypical EfficiencyKey Enhancement Strategies
Standard mitochondrial transformation0.1-1 transformants per μg DNAExtended homology regions
Biolistic transformation1-10 transformants per μg DNAOptimized particle and pressure settings
Enhanced protocol5-50 transformants per μg DNACombined approaches with specialized recipient strains

These optimizations can increase transformation efficiency by an order of magnitude, making previously challenging experiments feasible.

How can researchers differentiate between assembly defects and functional defects in COX3 mutants?

Distinguishing whether COX3 mutations affect assembly of Complex IV or the function of properly assembled complexes requires a multilayered analytical approach:

  • Quantitative complex assembly analysis:

    • Blue Native PAGE followed by western blotting with antibodies against multiple subunits

    • Sucrose gradient ultracentrifugation to separate assembled complexes from free subunits

    • Quantitative proteomics of mitochondrial fractions

  • Functional assays of isolated complexes:

    • Spectrophotometric measurement of cytochrome c oxidation rates

    • Polarographic oxygen consumption measurements

    • Electron transfer kinetics using stopped-flow techniques

  • In vivo versus in vitro comparisons:

    • Whole-cell respiration measurements

    • Isolated mitochondria oxygen consumption

    • Purified complex activity assays

A systematic decision tree can guide interpretation:

  • If complex levels are reduced but activity per complex is normal: primary assembly defect

  • If complex levels are normal but activity per complex is reduced: primary functional defect

  • If both complex levels and activity per complex are affected: combined defect

This distinction has significant implications for understanding disease mechanisms and developing potential interventions. Assembly defects might benefit from approaches stabilizing protein-protein interactions, while functional defects might require different therapeutic strategies.

What are the best practices for analyzing data contradictions between biochemical assays and genetic phenotypes in COX3 studies?

When biochemical data and genetic phenotypes yield contradictory results in COX3 studies, researchers should implement a systematic reconciliation approach:

  • Temporal considerations: Biochemical measurements provide snapshots while genetic phenotypes reflect cumulative effects. Time-course experiments can reveal whether contradictions stem from temporal dynamics:

    • Measure biochemical parameters at multiple time points

    • Track genetic phenotypes throughout growth phases

    • Consider circadian or metabolic cycling effects

  • Threshold effects analysis: Determine whether contradictions arise from threshold effects where biochemical changes must reach certain levels to manifest as phenotypes:

    • Establish dose-response relationships

    • Quantify heteroplasmy levels precisely

    • Measure parameters across multiple growth conditions

  • Compensatory mechanism identification:

    • Transcriptomics to identify upregulated alternate pathways

    • Metabolomics to detect metabolic rewiring

    • Genetic interaction screening to find suppressors

  • Mixed-methods data integration approach :

    • Triangulate with multiple independent methods

    • Weight evidence based on methodological rigor

    • Develop integrative mathematical models

When analyzing contradictory data, explicitly distinguish between correlation (what is observed) and causation (the mechanistic explanation). Present alternative hypotheses that could explain the contradictions, and design experiments specifically to distinguish between these possibilities. This approach transforms apparent contradictions into opportunities for deeper mechanistic insights.

How might CRISPR-based approaches revolutionize COX3 research in Saccharomyces cerevisiae?

  • Mitochondrially-targeted base editors: By fusing cytidine or adenine deaminases to mitochondrially-targeted Cas9 nickase variants, researchers may achieve precise COX3 editing without requiring double-strand breaks.

  • RNA-free CRISPR systems: Development of systems using protein guides rather than RNA guides could overcome the RNA import limitation.

  • Indirect CRISPR applications:

    • Editing nuclear genes encoding mitochondrial import machinery

    • Manipulating nuclear-encoded COX3 assembly factors

    • Engineering synthetic nuclear-encoded COX3 variants with mitochondrial targeting sequences

These approaches could enable precise engineering of COX3 variants at unprecedented efficiency and speed, facilitating:

  • High-throughput mutant libraries

  • Multiplexed mutations across respiratory complexes

  • Previously impossible precise modifications

Future development of mitochondrial CRISPR systems would revolutionize not only basic research but also potential therapeutic approaches for mitochondrial diseases involving COX3 mutations.

What integrative approaches can advance our understanding of COX3's role in mitochondrial supercomplexes?

Recent research has shifted from studying isolated respiratory complexes to examining supercomplexes—stable associations between multiple respiratory chain complexes. Advanced integrative approaches to study COX3's role in supercomplex formation include:

  • Structural biology integration:

    • Cryo-electron microscopy of intact supercomplexes

    • Cross-linking mass spectrometry to identify interaction interfaces

    • Molecular dynamics simulations to understand dynamic associations

  • Functional respiromics:

    • High-resolution respirometry with substrate-uncoupler-inhibitor titration protocols

    • Flux control analysis to quantify control strengths

    • Electron flux mapping through different branches of the respiratory system

  • Systems biology approaches:

    • Multi-omics integration (proteomics, metabolomics, lipidomics)

    • Network analysis of protein-protein interactions

    • Mathematical modeling of respiratory chain kinetics

This integrative approach has revealed that COX3 contributes to critical interfaces in the III₂IV₂ supercomplex, with implications for respiratory efficiency, reactive oxygen species production, and adaptation to different metabolic states. Future research should examine how COX3 mutations specifically affect supercomplex stability and function, potentially revealing new mechanisms for mitochondrial disease pathogenesis.

How can synthetic biology approaches enhance our ability to study COX3 function and regulation?

Synthetic biology offers innovative approaches to manipulate and study COX3 beyond traditional methods:

  • Orthogonal translation systems: Developing mitochondrially-targeted orthogonal ribosomes and tRNAs would allow incorporation of non-canonical amino acids into COX3, enabling:

    • Site-specific fluorescent labeling for real-time visualization

    • Photo-crosslinking to capture transient interactions

    • Chemical handles for selective purification

  • Synthetic regulatory circuits:

    • Engineered riboswitches to control COX3 expression in response to specific metabolites

    • Light-responsive expression systems for precise temporal control

    • Feedback-controlled expression systems to maintain defined COX3 levels

  • Minimal respiratory chain engineering:

    • Creation of simplified respiratory complexes with minimal subunit composition

    • Functional replacement of COX3 with designed synthetic proteins

    • Cross-species hybrid complexes to identify essential functional domains

These approaches could disentangle the complex regulatory networks controlling COX3 expression and assembly, potentially leading to synthetic systems with enhanced efficiency or novel properties. Synthetic biology not only provides powerful research tools but may also pave the way for engineered yeast strains with optimized respiratory properties for biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.