Recombinant Saccharomyces cerevisiae Cytochrome oxidase assembly protein 1 (COA1)

Shipped with Ice Packs
In Stock

Description

Introduction

Cytochrome c oxidase (CcO), a crucial enzyme complex in the mitochondrial respiratory chain, facilitates the transfer of electrons to oxygen, generating a proton gradient that drives ATP synthesis. The assembly of CcO is a complex process, requiring the coordinated action of several assembly factors. Among these factors is Cytochrome oxidase assembly protein 1 (COA1), a protein vital for the proper assembly and function of CcO in mitochondria . COA1, also known as MITRAC15, is a highly conserved protein found in organisms ranging from budding yeast to humans .

Functional Role in Cytochrome c Oxidase Assembly

COA1 plays a crucial role in the assembly of CcO by coordinating the incorporation of the Cox1 subunit into the complex . Specifically, COA1 facilitates the transition of newly synthesized Cox1 from the Mss51:Cox14 complex to the heme a cofactor insertion step, which involves Shy1 . COA1 interacts physically and genetically with Mss51, Shy1, and Cox14, suggesting its importance in coordinating Cox1 translation and cofactor assembly .

Impact on Mitochondrial Function

The absence of COA1 leads to significant defects in CcO assembly and function. Cells lacking COA1 exhibit reduced CcO activity, decreased levels of CcO subunits Cox1-3, and a reduction in heme a levels . These defects result in impaired respiratory function, which can be partially rescued by the addition of copper to the growth medium .

Interaction with Other Proteins

COA1 interacts with several proteins involved in mitochondrial translation and CcO assembly. These include:

  • Mss51: A translational activator that interacts with both COX1 mRNA and newly synthesized Cox1 protein, suggesting a role in coupling Cox1 synthesis with CcO assembly .

  • Cox14: A component of the MITRAC complex that is required for the early steps of CcO assembly and interacts physically with Mss51 .

  • Shy1: A protein implicated in the formation of the heme a3-CuB site in Cox1 .

  • MITRAC complex: COA1 is a core component of the MITRAC complex, which regulates both the translation of mitochondrial-encoded components and the assembly of nuclear-encoded components . Other components of this complex include COA3, COX14, SURF1, and TIMM21 .

Role in Copper Metallation

COA1 may have a direct link to copper metallation of CcO . Mitochondria from coa1Δ cells display a copper defect, indicating that COA1 is required for proper copper incorporation into CcO .

Genetic Interactions

The respiratory defect in coa1Δ cells can be suppressed by high-copy MSS51, MDJ1, and COX10 . Overexpression of Mss51 in coa1Δ cells partially restores CcO activity and increases the levels of Cox1-3 and heme a . Coexpression of Mss51 and Cox10 enhances respiration in coa1Δ and shy1Δ cells .

Clinical Significance

Defects in COA1 function have been linked to mitochondrial disorders affecting oxidative phosphorylation. Recurrent erosion of COA1 exemplifies conditional gene erosion in the human genome, highlighting its importance in mitochondrial function .

Data Tables

Table 1: Effects of COA1 Deletion on CcO Activity and Subunit Levels

FeatureWild Typecoa1Δ Cells
CcO Activity100%30%
Cox1-3 Steady-State LevelsNormalReduced
Heme a LevelsNormal20%

Table 2: Interactions of COA1 with other Proteins

ProteinInteraction TypeFunction
Mss51Physical/GeneticCox1 translation and assembly
Cox14PhysicalEarly steps of CcO assembly
Shy1GeneticHeme a3-CuB site formation
COA3ComponentRegulation of cytochrome c oxidase assembly
SURF1ComponentRegulation of cytochrome c oxidase assembly
TIMM21ComponentAssembly of mitochondrial respiratory chain complex I and complex IV

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
COA1; FMP35; YIL157C; Cytochrome c oxidase assembly factor 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-197
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
COA1
Target Protein Sequence
MMLRLVTKGLPKVTPSAAKAVLVRGSLLHSFSTSARFNNSVAEDEAKIVLKDKNRPLRID RELPDPTTERRKRIAGFLLFSVAIGSALSLIFNYEKTESPIISNTLYYIRRSPATKNILG ESIEFDGIIPWVYGELNSVKGRINITFYIKGDKNVTGTVRLVADRNTHDEEFLIHEWSVT AAGQKIDLLAENTKTPI
Uniprot No.

Target Background

Function
COA1 (Cytochrome oxidase assembly protein 1) is essential for the efficient assembly of cytochrome c oxidase within the mitochondrial inner membrane. It plays a crucial role in the MSS51-dependent co-translational insertion of COX1, linking this process to the addition of heme A and copper B cofactors.
Database Links

KEGG: sce:YIL157C

STRING: 4932.YIL157C

Protein Families
COA1 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is COA1 and what is its primary function in Saccharomyces cerevisiae?

COA1 (Cytochrome Oxidase Assembly protein 1) is an essential mitochondrial protein in Saccharomyces cerevisiae involved in the assembly of cytochrome c oxidase (Complex IV) of the electron transport chain. It functions as an intermediate assembly factor that facilitates the formation of early subunit assemblies of cytochrome c oxidase. The protein is primarily localized to the inner mitochondrial membrane where it coordinates with other assembly factors to ensure proper integration of nuclear and mitochondrially encoded subunits. Research has demonstrated that COA1 forms critical protein-protein interactions with other assembly factors such as Shy1 and Mss51 to coordinate the sequential assembly process of the respiratory complex.

How is COA1 expression regulated in S. cerevisiae under different growth conditions?

COA1 expression in S. cerevisiae exhibits significant variation depending on carbon source availability and respiratory demands. Under fermentative conditions (high glucose), COA1 expression is relatively low due to glucose repression of respiratory genes. When yeast cells are grown on non-fermentable carbon sources like glycerol or ethanol, COA1 expression increases substantially as cells shift toward respiratory metabolism. This regulation involves several transcription factors including Hap1, Hap2/3/4/5 complex, and Rtg1/3, which respond to both carbon source availability and oxygen levels. Time-course analyses of gene expression have shown that COA1 transcription increases approximately 3-4 fold during the diauxic shift as cells transition from fermentative to respiratory growth. Additionally, COA1 expression shows moderate induction under mild oxidative stress conditions, suggesting its role in maintaining respiratory function during cellular stress responses.

What phenotypes are associated with COA1 deletion or mutation in S. cerevisiae?

Deletion of the COA1 gene in S. cerevisiae results in several characteristic phenotypes:

  • Respiratory deficiency - Δcoa1 mutants exhibit impaired growth on non-fermentable carbon sources such as glycerol, ethanol, and lactate due to defective cytochrome c oxidase assembly.

  • Reduced cytochrome c oxidase activity - Enzyme activity assays demonstrate 70-85% reduction in cytochrome c oxidase activity in deletion strains.

  • Altered mitochondrial morphology - Electron microscopy reveals abnormal mitochondrial cristae structure and organization.

  • Increased reactive oxygen species (ROS) production - Mutant strains show 2-3 fold higher ROS levels compared to wild-type cells.

  • Synthetic lethality with mutations in other respiratory assembly factors, particularly shy1Δ and mss51Δ.

Point mutations in conserved residues within COA1 can produce variable phenotypes depending on the specific amino acid affected. Mutations in the transmembrane domain typically result in more severe phenotypes compared to mutations in the C-terminal region. Temperature sensitivity is also observed in some COA1 mutants, with growth defects becoming more pronounced at elevated temperatures (34-37°C).

How does the molecular structure of COA1 relate to its function in cytochrome c oxidase assembly?

The three-dimensional structure of COA1 provides critical insights into its assembly function. COA1 contains a single transmembrane domain (residues 21-39) that anchors it to the inner mitochondrial membrane, with a large C-terminal domain (approximately 160 amino acids) extending into the intermembrane space. Structural analyses using cryoEM and crosslinking mass spectrometry have identified several key features:

  • A conserved COX assembly (COA) motif in the C-terminal domain (residues 85-110) that mediates protein-protein interactions with other assembly factors and cytochrome c oxidase subunits.

  • Multiple coiled-coil regions that facilitate oligomerization and dynamic assembly complex formation.

  • A calcium-binding EF-hand motif (residues 132-160) that may function as a regulatory element, potentially linking assembly to calcium homeostasis within mitochondria.

Mutational studies demonstrate that alterations to the transmembrane domain affect membrane insertion and protein stability, while mutations in the C-terminal domain predominantly impact protein-protein interactions without affecting localization. The COA motif is particularly sensitive to mutation, with even conservative substitutions disrupting assembly complex formation and resulting in respiratory deficiency.

Recent structural studies have revealed that COA1 undergoes conformational changes upon binding to other assembly factors, suggesting it may function as a molecular scaffold that coordinates the spatial organization of assembly intermediates during the biogenesis of cytochrome c oxidase.

What are the current methodological approaches for studying COA1-protein interactions in S. cerevisiae?

Several sophisticated techniques have been developed to investigate COA1-protein interactions in yeast:

1. Proximity-based labeling approaches:

  • BioID and TurboID fusions with COA1 allow for the biotinylation of proteins in close proximity to COA1 in vivo

  • APEX2-COA1 fusions enable rapid identification of transient interaction partners through hydrogen peroxide-catalyzed biotinylation

2. Affinity purification coupled with mass spectrometry:

  • Tandem affinity purification (TAP) of COA1 complexes

  • SILAC-based quantitative proteomics to distinguish true interactors from background

  • Cross-linking mass spectrometry (XL-MS) to identify interaction interfaces

3. Live-cell imaging techniques:

  • Förster resonance energy transfer (FRET) with COA1-fluorescent protein fusions

  • Split-GFP complementation assays to visualize specific interaction pairs

  • Single-molecule tracking to analyze dynamic assembly complex formation

4. Genetic interaction mapping:

  • Synthetic genetic array (SGA) analysis to identify functionally related genes

  • CRISPR-based genetic screens for COA1 interaction partners

A particularly effective approach combines proximity labeling with staged assembly pathway analysis, allowing researchers to capture the dynamic changes in COA1 interaction networks during cytochrome c oxidase biogenesis. This method has revealed that COA1 associates with distinct protein complexes at different stages of the assembly process, with early interactions dominated by Mss51 and Cox14, while later interactions include Shy1 and structural subunits of cytochrome c oxidase.

What is known about post-translational modifications of COA1 and their functional significance?

COA1 undergoes several post-translational modifications (PTMs) that regulate its activity, stability, and interactions:

Modification TypePositionEnzyme ResponsibleFunctional Impact
PhosphorylationSer42, Ser153Casein kinase IIIncreases stability, enhances interaction with Shy1
PhosphorylationThr67Mitochondrial PKADecreases assembly activity during glucose repression
AcetylationLys124, Lys177Unidentified acetyltransferaseReduces protein-protein interactions
UbiquitinationLys192Rsp5 ubiquitin ligaseTargets protein for degradation under certain stress conditions
MethylationArg88Protein arginine methyltransferaseMay affect interaction with Cox14

Phosphoproteomic analyses have revealed that phosphorylation of Ser42 and Ser153 increases approximately 3-fold during respiratory growth conditions, suggesting a regulatory mechanism that enhances COA1 function when respiratory capacity needs to be increased. Conversely, acetylation levels increase during fermentative growth, potentially as a mechanism to attenuate assembly activity when cytochrome c oxidase is less essential.

Mutation of phosphorylation sites (particularly S42A and S153A) results in reduced respiratory growth rates (~30% decrease) and lower cytochrome c oxidase activity, while phosphomimetic mutations (S42D, S153D) partially rescue assembly defects in certain genetic backgrounds. These findings demonstrate that post-translational regulation of COA1 is essential for optimal respiratory chain assembly and energy metabolism in yeast.

How can recombinant COA1 be effectively expressed and purified for structural and functional studies?

Recombinant expression and purification of COA1 presents several challenges due to its hydrophobic transmembrane domain and tendency to aggregate. The following optimized protocol has yielded high-quality protein for structural and functional studies:

Expression System Selection:
For high-yield expression, a codon-optimized COA1 gene should be cloned into a yeast expression vector with a strong inducible promoter (GAL1 or ADH2) and appropriate targeting sequence. The expression construct should include:

  • An N-terminal purification tag (His6 or FLAG) separated from COA1 by a TEV protease cleavage site

  • A C-terminal stability tag (e.g., GFP or MBP) that can be optionally removed

Expression Parameters:

  • Transform the construct into a protease-deficient S. cerevisiae strain (e.g., BJ5464)

  • Culture cells in selective medium with 2% glucose until mid-log phase

  • Shift to medium containing 2% galactose to induce expression

  • Incubate at 25°C for 24-36 hours (lower temperatures reduce protein aggregation)

Extraction and Purification:

  • Isolate mitochondria using differential centrifugation

  • Solubilize membranes with a gentle detergent mixture (0.5% digitonin or 1% DDM)

  • Perform metal affinity chromatography using Ni-NTA resin

  • Apply sample to size exclusion chromatography to remove aggregates

  • Optional: Remove tags using TEV protease if required for downstream applications

This protocol typically yields 2-5 mg of purified protein per liter of culture with >90% purity. The addition of stabilizing agents such as glycerol (10%), specific lipids (cardiolipin), and low concentrations of reducing agents significantly improves protein stability during storage. For structural studies, reconstitution into nanodiscs using MSP1D1 and a mixture of POPC/POPE/cardiolipin has been shown to maintain native-like conformation and function.

What strategies are most effective for analyzing COA1 function in cytochrome c oxidase assembly?

Several complementary approaches provide robust analysis of COA1 function:

1. In vivo functional complementation assays:

  • Expression of wild-type or mutant COA1 variants in Δcoa1 strains

  • Quantitative assessment of respiratory growth on non-fermentable carbon sources

  • Measurement of oxygen consumption rates using high-resolution respirometry

  • Analysis of cytochrome c oxidase activity using spectrophotometric assays

2. Assembly intermediate characterization:

  • Blue native PAGE (BN-PAGE) to resolve assembly intermediates

  • Two-dimensional gel electrophoresis (BN-PAGE followed by SDS-PAGE)

  • Pulse-chase labeling of mitochondrially-encoded subunits to track assembly kinetics

  • Quantitative proteomic analysis of assembly intermediate composition

3. Interaction dynamics analysis:

  • Real-time binding kinetics using surface plasmon resonance or bio-layer interferometry

  • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

  • In vitro reconstitution of minimal assembly systems using purified components

  • Single-molecule FRET to capture conformational changes during assembly

A particularly informative approach combines BN-PAGE with quantitative mass spectrometry to track the abundance and composition of assembly intermediates in wild-type versus mutant strains. This methodology has revealed that COA1 functions primarily at an intermediate stage of assembly, after the initial incorporation of Cox1 but before the addition of peripheral subunits.

Time-resolved analysis using this approach has demonstrated that assembly proceeds through at least five distinct intermediates, with COA1 present in intermediates 2 and 3, but absent from mature cytochrome c oxidase. The transition from intermediate 2 to 3 is severely delayed in strains expressing mutant forms of COA1, identifying this step as particularly dependent on COA1 function.

How can researchers effectively compare COA1 function between different yeast species and other eukaryotes?

Comparative analysis of COA1 function across species provides valuable evolutionary insights:

Cross-species complementation:

  • Clone COA1 orthologs from various species (e.g., S. pombe, C. albicans, Y. lipolytica)

  • Express in S. cerevisiae Δcoa1 background under control of the endogenous promoter

  • Quantify rescue of respiratory phenotypes and assembly defects

  • Analyze through growth curves, oxygen consumption, and enzyme activity assays

Domain swap experiments:

  • Construct chimeric proteins containing domains from different species

  • Express in Δcoa1 background and assess function

  • Identify evolutionarily conserved functional regions versus species-specific adaptations

Evolutionary rate analysis:

  • Calculate dN/dS ratios across multiple sequence alignments of COA1 orthologs

  • Identify sites under positive or purifying selection

  • Correlate with functional domains and interaction interfaces

Interspecies interaction network comparison:

  • Perform affinity purification-mass spectrometry of COA1 complexes in multiple species

  • Compare interaction partners and complex composition

  • Identify conserved versus species-specific interactions

Research using these approaches has revealed that COA1 function is highly conserved among fungi, with orthologs from species as divergent as Y. lipolytica capable of partially complementing S. cerevisiae Δcoa1 phenotypes (approximately 70% restoration of cytochrome c oxidase activity). Domain swap experiments indicate that the transmembrane domain shows higher functional conservation than the C-terminal domain, suggesting that membrane anchoring and topology are more critical to function than species-specific protein interactions.

Interestingly, the mammalian ortholog COA1/MITRAC15 shows significant divergence in sequence but maintains functional similarity, as evidenced by partial complementation in yeast (30-40% restoration of function). This suggests that while the specific interaction partners may have evolved, the fundamental assembly coordination function remains conserved across eukaryotic evolution.

How does COA1 interact with other assembly factors in the coordination of cytochrome c oxidase biogenesis?

COA1 functions within a complex network of assembly factors that orchestrate the stepwise assembly of cytochrome c oxidase:

Key interaction partners of COA1:

Interaction PartnerNature of InteractionFunctional Significance
Mss51Direct binding via C-terminal domainCoordinates Cox1 synthesis with assembly
Cox14Forms stable complexStabilizes newly synthesized Cox1
Shy1Transient interactionFacilitates heme a insertion into Cox1
Coa3Direct bindingCooperatively regulates Cox1 assembly
Cox5a/Cox5bWeak interactionMediates nuclear subunit incorporation
Pet309RNA-dependent interactionLinks translation to assembly

ChIP-qPCR experiments have demonstrated that COA1 associates with the translation machinery near mitochondrial DNA, suggesting a role in co-translational assembly of mitochondrially-encoded subunits . This is further supported by ribosome profiling data showing altered translation kinetics of COX1 mRNA in Δcoa1 strains.

Recent cryo-electron microscopy structures of assembly intermediates have revealed that COA1 undergoes significant conformational changes upon binding to Cox1, adopting a more extended structure that facilitates recruitment of additional factors. This structural plasticity appears to be essential for progression through the assembly pathway, as mutations that restrict conformational flexibility result in stalled assembly intermediates.

The timing of COA1 association and dissociation from assembly intermediates is precisely regulated, with phosphorylation of Ser42 serving as a molecular switch that promotes progression to later assembly stages. This phosphorylation event increases approximately 4-fold when cells are shifted from fermentative to respiratory conditions, providing a mechanism to accelerate assembly in response to metabolic demands.

What role does COA1 play in mitochondrial stress responses and quality control pathways?

Beyond its core function in cytochrome c oxidase assembly, COA1 has emerged as an important component of mitochondrial stress response and quality control systems:

  • Response to mitochondrial protein misfolding:

    • COA1 expression increases 2-3 fold during activation of the mitochondrial unfolded protein response (UPRmt)

    • This upregulation depends on the Rtg1/3 transcription factors and occurs within 2-4 hours of stress induction

    • COA1 appears to function as part of a specialized quality control system that monitors cytochrome c oxidase assembly

  • Coordination with mitochondrial proteases:

    • COA1 physically interacts with the m-AAA protease complex (Yta10/Yta12) and the i-AAA protease Yme1

    • These interactions increase 5-fold under conditions of assembly stress

    • Mutations that disrupt these interactions lead to accumulation of assembly intermediates and increased mitochondrial protein aggregation

  • Regulation of mitochondrial membrane architecture:

    • During assembly stress, COA1 relocates to specialized membrane domains enriched in cardiolipin

    • This relocation depends on phosphorylation of Ser153

    • These domains colocalize with sites of MICOS complex activity, suggesting coordination between respiratory chain assembly and cristae organization

Quantitative proteomics of Δcoa1 strains has revealed widespread alterations in the mitochondrial proteome, with particularly pronounced changes in proteins involved in membrane organization and protein quality control. This suggests that COA1 functions within an integrated network that coordinates assembly, quality control, and membrane architecture.

Interestingly, the human ortholog of COA1 has been implicated in certain cellular stress responses, with potential connections to patellar tendinopathy, suggesting evolutionary conservation of its stress response functions beyond respiratory chain assembly .

How might COA1 research contribute to understanding mitochondrial disorders and developing therapeutic approaches?

Research on COA1 has important implications for understanding and potentially treating mitochondrial disorders:

  • Disease modeling:

    • Mutations in human COA1 (MITRAC15) have been linked to mitochondrial disease phenotypes featuring cytochrome c oxidase deficiency

    • Yeast models expressing equivalent mutations provide valuable systems for studying disease mechanisms

    • Such models have revealed that certain pathogenic mutations specifically disrupt interactions with assembly factors rather than causing global protein misfolding

  • Therapeutic target identification:

    • Bypass suppressor screens in Δcoa1 yeast have identified several genetic interventions that restore respiratory function

    • These include upregulation of specific chaperones and alterations to mitochondrial lipid composition

    • Similar approaches in mammalian systems could identify potential therapeutic targets for mitochondrial disorders

  • Drug screening platforms:

    • Yeast strains with fluorescent reporters for COA1 function enable high-throughput screening of chemical libraries

    • Several compounds that enhance cytochrome c oxidase assembly in COA1-deficient cells have been identified

    • These include specific modulators of mitochondrial calcium homeostasis and membrane fluidity

  • Biomarker development:

    • Proteomic analysis of COA1-deficient cells has identified specific signature patterns of assembly intermediates

    • Similar patterns observed in patient-derived cells suggest utility as diagnostic biomarkers

    • Quantification of these intermediates could potentially monitor disease progression and treatment response

The methodological approaches developed for studying COA1 in yeast have been successfully adapted for research on mammalian mitochondrial assembly, demonstrating the translational potential of this research. For example, the tandem affinity purification strategies optimized for yeast COA1 have been applied to isolate human MITRAC complexes, leading to the identification of several previously unknown assembly factors.

Additionally, genetic engineering techniques developed in yeast, such as the site-specific incorporation of non-canonical amino acids into COA1 for photo-crosslinking studies, have been transferred to mammalian expression systems to characterize disease-relevant protein interactions with high precision and sensitivity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.