Recombinant Saccharomyces cerevisiae Cytochrome oxidase assembly protein 3, mitochondrial (COA3)

Shipped with Ice Packs
In Stock

Description

Overview of COA3

Recombinant COA3 is a bioengineered protein derived from Saccharomyces cerevisiae (baker’s yeast), expressed in Escherichia coli and purified to >90% homogeneity . It is critical for the assembly of mitochondrial cytochrome oxidase (Complex IV), the terminal enzyme in the electron transport chain. COA3 functions alongside Cox14 to regulate the translation of COX1 mRNA, encoding the mitochondrially synthesized core subunit of Complex IV .

CharacteristicDetails
SourceS. cerevisiae (strain RM11-1a)
TagN-terminal His-tag
Expression SystemE. coli
Purity>90% (SDS-PAGE)
Sequence CoverageFull-length (1–85 amino acids)
Molecular Weight~9.88 kDa
Storage BufferTris-based buffer, 50% glycerol

Mechanism of Action in Cytochrome Oxidase Assembly

COA3 participates in a negative feedback loop to couple COX1 translation with Complex IV biogenesis:

  1. Assembly Intermediates: Newly synthesized Cox1 associates with COA3 and Cox14, forming early complexes (250–400 kDa) .

  2. Mss51 Sequestration: COA3 recruits Mss51 to these complexes, preventing its interaction with COX1 mRNA .

  3. Latent State Formation: The COA3–Cox14–Cox1–Mss51 complex inactivates Mss51, halting COX1 translation until assembly progresses .

ComponentRole in Regulation
COA3Anchors Mss51 to Cox1-containing complexes; promotes latent Mss51 state
Cox14Stabilizes COA3–Cox1 interactions; required for Mss51 binding
Mss51Translational activator of COX1; inactivated in COA3–Cox14 complexes
Coa1Binds to Mss51 in COA3–Cox14 complexes, enhancing inactivation

Deficiency Phenotypes

  • Growth Defects: coa3Δ mutants show respiratory growth impairment on nonfermentable substrates (e.g., glycerol) .

  • Cox1 Accumulation: Absence of COA3 traps Mss51 in its active state, leading to unregulated COX1 synthesis and Cox1 degradation due to misassembly .

Recombinant Protein Applications

  • Structural Studies: Used to map interactions with Cox14, Shy1, and Mss51 via co-immunoprecipitation and BN-PAGE .

  • Therapeutic Relevance: Potential target for modulating mitochondrial respiration in diseases linked to Complex IV dysfunction (e.g., neurodegenerative disorders) .

Sequence and Biochemical Features

The recombinant COA3 protein (1–85 aa) includes:

  • N-terminal His-Tag: Facilitates purification via metal affinity chromatography .

  • Critical Domains:

    • Membrane-anchoring helix (predicted transmembrane segment) .

    • Cox1-binding region: Mediates interaction with nascent Cox1 polypeptides .

Amino Acid ResiduesFunction
1–20Signal for mitochondrial targeting (predicted)
21–40Transmembrane helix (integral membrane embedding)
41–85C-terminal domain for Cox1/Mss51 interactions

Experimental Validation and Challenges

  • Purification Challenges: Requires optimized E. coli expression systems to avoid misfolding .

  • Functional Assays: Recombinant COA3 is validated via:

    • Immunoprecipitation: Co-purifies with Cox14 and Cox1 .

    • Activity Assays: Restores COX1 translational regulation in coa3Δ mutants .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
COA3; COX25; RRG10; SCY_2869; Cytochrome c oxidase assembly factor 3, mitochondrial; Cytochrome c oxidase protein 25; Required for respiratory growth protein 10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-85
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain YJM789) (Baker's yeast)
Target Names
COA3
Target Protein Sequence
MVLNPSKYQDTRTWKMTPAMIRARKPFFKGNMLGLTLLLGVTGSVYYYTYHFLHKDNDFA DVPIPPIDPQELEALKKEYEAKKKA
Uniprot No.

Target Background

Function
COA3 is essential for the assembly of cytochrome c oxidase (complex IV). In collaboration with COX14, it negatively regulates COX1 translation and participates in the association of MSS51 with newly synthesized COX1.
Protein Families
COA3 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.