Recombinant Saccharomyces cerevisiae Cytochrome oxidase assembly protein SHY1 (SHY1)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
SHY1; YGR112W; G6150; Cytochrome oxidase assembly protein SHY1; SURF1 homolog of Yeast; SURF1-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-389
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
SHY1
Target Protein Sequence
MSLLGARSTYRWFSIAASIPTKNAIGKSTYLLASRNQQYRGIITSTVDWKPIKTGKSPND
DSRRERSFGKKIVLGLMFAMPIISFYLGTWQVRRLKWKTKLIAACETKLTYEPIPLPKSF
TPDMCEDWEYRKVILTGHFLHNEEMFVGPRKKNGEKGYFLFTPFIRDDTGEKVLIERGWI
SEEKVAPDSRNLHHLSLPQEEHLKVVCLVRPPKKRGSLQWAKKDPNSRLWQVPDIYDMAR
SSGCTPIQFQALYDMKDHPIIEEHTRNEASQNNSTSSLWKFWKREPTTAVNGTQAVDNNT
SKPRSRQEMPTDQTIEFDERQFIKAGVPIGRKPTIDLKNNHLQYLVTWYGLSFLSTIFLI
VALRKAKRGGVVSQDQLMKEKLKHSRKYM
Uniprot No.
Target Background
Function
Essential for the efficient assembly of cytochrome c oxidase within the mitochondrial inner membrane. It plays a role in coupling MSS51-COX14-dependent regulation of COX1 translation to the initial stages of cytochrome c oxidase assembly.
Gene References Into Functions
- Shy1 does not function as a mobile heme carrier between heme a synthase and maturing Cox1; instead, it collaborates with Cox15 to facilitate heme transfer and insertion into early cytochrome c oxidase assembly intermediates. PMID: 23979592
- Replacing the conserved tyrosine (Y344) with aspartate in yeast SHY1 disrupts the coupling between Cox1 translational regulation and cytochrome c oxidase assembly. PMID: 21470975
- Analysis of Shy1 mutations (the SURF1 homolog) identified Coa4, a novel member of the cytochrome oxidase assembly factor family. PMID: 20624914
- Shy1 links Cox1 translational regulation to complex IV assembly and supercomplex formation. PMID: 17882259
Database Links
KEGG: sce:YGR112W
STRING: 4932.YGR112W
Protein Families
SURF1 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
