Recombinant Saccharomyces cerevisiae Degradation in the endoplasmic reticulum protein 1 (DER1)

Shipped with Ice Packs
In Stock

Description

Table 1: Key Properties of Recombinant Der1

PropertyDescription
Expression SystemEscherichia coli
TagN-terminal His-tag
Molecular Weight~24 kDa (calculated)
Functional PartnersHrd1, Usa1, Hrd3, Yos9 (ERAD-L complex)
Post-Translational ModificationN-terminal acetylation (NatB-dependent)

Mechanistic Role in ERAD

Recombinant Der1 has been pivotal in elucidating ERAD-L (luminal substrate degradation):

  • Substrate threading: Der1 initiates misfolded protein export by threading them into the ER membrane .

  • Coordination with Cdc48: Der1-dependent substrates require the AAA+ ATPase Cdc48 for extraction to the cytosol .

  • Degron recognition: Recent studies identified DegV1, a portable degron tag dependent on Der1-Hrd1 for ERAD-mediated proteasomal degradation .

Functional Validation

  • Genetic studies: der1Δ yeast strains show abolished ERAD-L activity but no growth defects, confirming Der1’s specialized role .

  • Proteolytic regulation: Unacetylated Der1 is degraded via Hrd1 itself, revealing autoregulatory feedback .

Cross-Species Relevance

  • Mammalian homologs: Der1 shares functional homology with derlin-1, enabling translational studies of ER stress diseases .

  • Degron engineering: Der1-dependent DegV1 tags enable targeted degradation of endogenous ER proteins in yeast and mammalian cells .

Industrial and Therapeutic Implications

  • Protein quality control: Recombinant Der1 aids in optimizing heterologous protein production by mitigating ER stress in yeast expression systems .

  • Drug discovery: Der1-Hrd1 interactions are targets for modulating ERAD in diseases like cystic fibrosis and neurodegeneration .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution. Store at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference for your use.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
DER1; YBR201W; YBR1413; Degradation in the endoplasmic reticulum protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-211
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
DER1
Target Protein Sequence
MDAVILNLLGDIPLVTRLWTIGCLVLSGLTSLRIVDPGKVVYSYDLVFKKGQYGRLLYSI FDYGAFNWISMINIFVSANHLSTLENSFNLRRKFCWIIFLLLVILVKMTSIEQPAASLGV LLHENLVYYELKKNGNQMNVRFFGAIDVSPSIFPIYMNAVMYFVYKRSWLEIAMNFMPGH VIYYMDDIIGKIYGIDLCKSPYDWFRNTETP
Uniprot No.

Target Background

Function
Degradation in the endoplasmic reticulum protein 1 (DER1) is a component of the endoplasmic reticulum-associated degradation (ERAD) pathway. It is specifically required for the ERAD-L pathway, which mediates the degradation of proteins with misfolded lumenal domains within the endoplasmic reticulum (ER). DER1 facilitates the retrotranslocation of misfolded proteins from the ER lumen through the ER membrane in conjunction with HRD1. Both proteins possess lateral gates facing each other and distort the membrane region between these gates, making it significantly thinner than a normal phospholipid bilayer. Substrates insert into the membrane as a hairpin loop, with one strand interacting with DER1 and the other with HRD1.
Gene References Into Functions
  1. Data indicate that N-terminal acetylation of Der1 regulates its degradation by the Hrd1 ligase. PMID: 23363603
  2. Der1p degradation complex is enriched in a Cdc48p cofactor Ufd1p. PMID: 18407841
Database Links

KEGG: sce:YBR201W

STRING: 4932.YBR201W

Protein Families
Derlin family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the fundamental function of DER1 in Saccharomyces cerevisiae?

DER1 encodes a novel, hydrophobic protein localized to the endoplasmic reticulum (ER) in Saccharomyces cerevisiae. It plays a specific and essential role in the proteolytic system that selectively degrades misfolded luminal secretory proteins within the ER . Studies have shown that DER1 deletion abolishes the degradation of substrate proteins, confirming its critical function in the ER-associated degradation pathway . DER1 appears to act in a process that directly removes proteins from the folding environment of the ER, as demonstrated by the fact that in DER1-deleted cells, substrate proteins for ER degradation are retained in the ER through the same mechanism that retains luminal ER residents .

How was DER1 initially discovered and characterized?

DER1 was discovered through a mutant isolation approach aimed at identifying components involved in ER protein degradation in Saccharomyces cerevisiae. Researchers isolated mutants that could be divided into four complementation groups, all leading to the stabilization of two different substrate proteins targeted for degradation. These mutant classes were collectively named "der" for "degradation in the ER" . Specifically, DER1 was cloned by complementation of the der1-2 mutation, revealing a novel gene encoding a hydrophobic ER-localized protein . This methodical mutant isolation and complementation approach provided the foundation for understanding the specific role of DER1 in ER protein quality control.

What is the molecular structure of Der1 protein and how does it contribute to its function?

Der1 is a hydrophobic protein with multiple transmembrane domains that facilitate its integration into the ER membrane . Research indicates that Der1 forms oligomers, a process dependent on its interaction with the scaffolding protein Usa1 . The protein's structure is critical to its function, as mutations in the transmembrane domains of Der1 block the passage of soluble proteins across the ER membrane . Site-specific photocrosslinking studies have revealed that the ER-luminal exposed parts of Der1 are in spatial proximity to the substrate receptor Hrd3, while the membrane-embedded domains are adjacent to the ubiquitin ligase Hrd1 . Both regions form crosslinks to client proteins, suggesting that Der1's structural arrangement allows it to interact with misfolded proteins and facilitate their movement through the ER membrane.

How does Der1 facilitate the movement of misfolded proteins through the ER membrane?

Der1 plays a crucial role in initiating the export of aberrant polypeptides from the ER lumen by threading such molecules into the ER membrane and routing them to Hrd1 for ubiquitylation . The process involves several steps: first, Der1 recognizes and binds to misfolded proteins in the ER lumen through its luminal domains that interact with substrate receptors like Hrd3 . Then, Der1's transmembrane domains create a pathway through which these misfolded proteins can be threaded across the lipid bilayer . This function is critical because it bridges the gap between substrate recognition in the ER lumen and the cytosolic ubiquitination machinery, effectively solving the topological problem of how luminal misfolded proteins can be accessed by the cytosolic proteasome.

What protein complexes does Der1 participate in and what are their components?

Der1 is a component of the HMG-CoA reductase degradation ligase (HRD-ligase) complex, which is responsible for polyubiquitylation of misfolded proteins extracted from the ER . The key components of this complex include:

ComponentLocationPrimary Function
Der1ER membraneFacilitates protein translocation through membrane
Hrd1ER membraneE3 ubiquitin ligase
Hrd3ER lumenSubstrate receptor
Usa1ER membraneScaffolding protein that facilitates Der1 oligomerization
Cdc48/p97CytosolicATP-dependent extraction of ubiquitylated proteins

Der1's interaction with Usa1 is particularly important as it enables Der1 to oligomerize, which is believed to be necessary for creating a protein-conducting channel or environment through which substrate proteins can pass . The spatial organization of this complex positions Der1 between the substrate recognition components (Hrd3) and the ubiquitination machinery (Hrd1), making it ideally suited for its role in protein translocation.

What are the most effective methods for expressing recombinant DER1 in laboratory settings?

For recombinant expression of DER1, researchers typically use yeast expression systems with inducible promoters such as GAL1. The methodology involves:

  • Vector Design: Create expression constructs containing the DER1 sequence under control of an inducible promoter with appropriate selection markers and fusion tags (e.g., His-tag, FLAG-tag) for detection and purification.

  • Transformation Protocol: Transform the construct into a suitable Saccharomyces cerevisiae strain, preferably one with the endogenous DER1 deleted to prevent interference with the recombinant protein.

  • Expression Conditions: Induce expression using appropriate conditions (for GAL1, typically 2% galactose in media lacking glucose) and optimize temperature (usually 25-30°C) and induction time (typically 4-8 hours).

  • Membrane Protein Extraction: Since Der1 is a membrane protein, use specialized extraction buffers containing detergents like n-Dodecyl β-D-maltoside (DDM) or digitonin at 1-2% concentration to solubilize the protein while maintaining its native conformation.

  • Purification Strategy: Employ affinity chromatography based on the fusion tag, followed by size exclusion chromatography to obtain purified Der1 protein or Der1-containing complexes.

For functional studies, researchers often complement der1Δ strains with recombinant DER1 variants to assess functionality through substrate degradation assays.

What are the recommended approaches for studying Der1's interaction with the HRD ligase complex?

Studying Der1's interactions with the HRD ligase complex requires multiple complementary approaches:

  • Co-immunoprecipitation (Co-IP): Use epitope-tagged versions of Der1 and other complex components to pull down the complex and analyze composition. Crosslinking agents prior to Co-IP can stabilize transient interactions.

  • Site-specific Photocrosslinking: This technique has been particularly valuable for mapping Der1's spatial relationships within the complex. It involves introducing photoreactive amino acids at specific positions in Der1 and activating them with UV light to form covalent bonds with adjacent proteins .

  • Blue Native PAGE: This technique preserves protein complexes during electrophoresis and can be used to analyze the native state of the HRD ligase complex and how Der1 contributes to its assembly.

  • Fluorescence Resonance Energy Transfer (FRET): By tagging Der1 and potential interaction partners with appropriate fluorophores, researchers can detect proximity-dependent energy transfer, confirming interactions in vivo.

  • Yeast Two-Hybrid Membrane Protein System: Modified Y2H systems designed for membrane proteins can detect binary interactions between Der1 and other components.

  • Cryo-electron Microscopy: For structural analysis of the entire complex, cryo-EM has become the method of choice, potentially revealing how Der1 is positioned within the larger HRD ligase assembly.

For all these approaches, appropriate controls must be included, such as using interaction-deficient mutants or unrelated membrane proteins to verify specificity.

How can researchers quantitatively assess DER1 function in ERAD pathways?

Quantitative assessment of DER1 function can be achieved through several complementary assays:

  • Substrate Degradation Kinetics: Express well-characterized ERAD substrates (e.g., CPY*, KHN) with epitope tags in wild-type and der1Δ strains, then perform cycloheximide chase assays. Quantify substrate levels at different time points using western blot and calculate half-lives. Effective DER1 function is indicated by faster substrate degradation compared to der1Δ controls.

  • Ubiquitination Assays: Express His-tagged ubiquitin and ERAD substrates in various strains, then pull down ubiquitinated proteins under denaturing conditions. Quantify substrate ubiquitination levels, which should be reduced in der1Δ strains for DER1-dependent substrates.

  • ER Retention Assays: Use glycosylation status or subcellular fractionation to determine whether ERAD substrates remain in the ER (indicating defective extraction) in the absence of functional DER1.

  • Flow Cytometry with Fluorescent Reporters: Create fusion proteins of ERAD substrates with fluorescent proteins. Higher fluorescence indicates substrate stabilization due to compromised ERAD function.

  • In Vitro Translocation Assays: Using isolated ER microsomes, assess the ability of recombinant or native Der1 to facilitate movement of model substrates across the membrane, quantifying the translocated fraction.

The following table summarizes typical results from substrate degradation assays comparing wild-type and der1Δ strains:

ERAD SubstrateHalf-life in WT (min)Half-life in der1Δ (min)Fold Stabilization
CPY*20-3090-1203-4×
KHN25-3580-1002.5-3×
Sec61-210-1512-181-1.2× (Der1-independent)

How does Der1 oligomerization contribute to its role in protein translocation, and what experimental approaches can address this question?

Der1 oligomerization, which depends on its interaction with the scaffolding protein Usa1, appears to be crucial for creating a protein-conducting environment through which ERAD substrates can pass through the ER membrane . To investigate this complex process, researchers can employ several sophisticated approaches:

  • Cysteine Crosslinking Assays: Engineer cysteine residues at predicted interaction interfaces in Der1 and assess spontaneous or catalyzed disulfide bond formation between Der1 molecules. By varying the positions of introduced cysteines, a map of the oligomeric interface can be developed.

  • Single-Molecule Fluorescence Techniques: Utilize techniques such as single-molecule FRET or fluorescence correlation spectroscopy (FCS) to analyze the dynamics of Der1 oligomerization in real-time within membranes. This approach can reveal the stoichiometry and assembly kinetics of Der1 complexes.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This method can identify regions of Der1 that become protected upon oligomerization, providing insights into the structural changes associated with complex formation.

  • Mutational Analysis Combined with Functional Assays: Create a library of Der1 mutants at conserved residues and assess both their ability to oligomerize and to facilitate substrate degradation. This correlation can establish which specific oligomeric interactions are functionally relevant.

  • Electron Microscopy of Reconstituted Systems: Reconstitute Der1 oligomers in artificial membrane systems and visualize their structure using negative stain or cryo-electron microscopy to determine if they form channel-like assemblies.

Current models suggest that Der1 oligomers might form a flexible channel or a protected environment rather than a rigid pore, allowing diverse misfolded proteins to be accommodated during translocation.

What is the relationship between DER1 and cellular longevity, and how can researchers design experiments to further explore this connection?

The observation that deletion of DER1 increases replicative lifespan by approximately 16% in yeast presents an intriguing connection between ERAD and cellular aging. To explore this relationship, researchers could design the following experimental approaches:

  • Lifespan Analysis with DER1 Variants: Generate yeast strains expressing DER1 mutants with various levels of functionality and measure their replicative and chronological lifespans. This would establish whether the longevity effect is directly related to Der1's role in ERAD or another unknown function.

  • Proteostasis Assessment During Aging: Compare the global proteome stability in wild-type and der1Δ strains throughout their lifespan using quantitative proteomics. Focus particularly on known longevity-related proteins and pathways to identify potential mechanisms.

  • Stress Resistance Profiling: Assess resistance to various stressors (oxidative, ER, heat shock) in young and aged cells with and without DER1. This could reveal whether improved stress resistance underlies the longevity effect.

  • Epistasis Analysis with Longevity Pathways: Combine der1Δ with deletions or modifications of genes involved in established longevity pathways (TOR, Sir2, Ras/PKA) to determine if DER1's effect is dependent on or additive with these pathways.

  • ER Morphology and Function During Aging: Examine ER structure, UPR activity, and ERAD capacity throughout the lifespan in wild-type and der1Δ strains to understand how DER1 deletion affects ER homeostasis during aging.

A theoretical model explaining DER1's impact on longevity might involve reduced degradation of certain beneficial proteins or altered ER stress responses that promote cellular health. The experiments above would help distinguish between these possibilities and potentially reveal new connections between protein quality control and aging.

How do post-translational modifications affect Der1 function, and what methods are appropriate for investigating these modifications?

Post-translational modifications (PTMs) of Der1 represent an understudied aspect that could significantly impact its function in ERAD. To investigate PTMs and their functional consequences, researchers should consider:

  • Global PTM Mapping: Employ mass spectrometry-based proteomics to identify all potential modification sites on Der1. This should include phosphorylation, ubiquitination, sumoylation, glycosylation, and acetylation analyses.

  • Site-directed Mutagenesis of Modified Residues: Once modification sites are identified, create non-modifiable mutants (e.g., Ser to Ala for phosphorylation sites) and constitutive modification mimics (e.g., Ser to Glu for phosphorylation) to assess functional consequences.

  • Modification-specific Antibodies: Develop antibodies that specifically recognize modified forms of Der1 to monitor modification dynamics under different cellular conditions.

  • Identification of Modifying Enzymes: Use genetic screens or candidate approaches to identify kinases, phosphatases, or other enzymes responsible for Der1 modifications. This could be accomplished through systematic gene deletion/overexpression followed by monitoring Der1 modification status.

  • Regulation During Stress Conditions: Examine how ER stress, unfolded protein response activation, or other cellular stresses affect Der1 modification patterns and correlate these changes with ERAD efficiency.

A hypothetical model of Der1 regulation might include phosphorylation-dependent control of its oligomerization state or its interactions with other ERAD components. Understanding these regulatory mechanisms could reveal how cells modulate ERAD capacity in response to changing physiological demands.

What are the most promising approaches for identifying novel Der1 substrates and substrate recognition mechanisms?

Identifying the full range of Der1-dependent substrates and understanding substrate recognition mechanisms remains challenging. Innovative approaches to address these questions include:

  • Global Proteomics in der1Δ vs. Wild-type: Use stable isotope labeling with amino acids in cell culture (SILAC) or tandem mass tag (TMT) labeling combined with mass spectrometry to identify proteins that accumulate in der1Δ strains. This unbiased approach can reveal previously unknown Der1 substrates.

  • Proximity Labeling Proteomics: Express Der1 fused to enzymes like BioID or APEX2 that biotinylate nearby proteins. This approach can identify proteins that transiently interact with Der1 during the degradation process.

  • Structural Analysis of Substrate-Der1 Complexes: Use cryo-electron microscopy or integrative structural biology approaches to capture Der1 in complex with substrates, potentially revealing binding interfaces and recognition elements.

  • Deep Mutational Scanning of Model Substrates: Create libraries of ERAD substrate variants with systematic mutations and assess their Der1-dependent degradation efficiency. This can identify sequence or structural features that determine Der1 dependence.

  • Computational Prediction and Validation: Develop machine learning algorithms trained on known Der1 substrates to predict new candidates based on sequence, structure, or other features, followed by experimental validation.

Current evidence suggests that Der1 may recognize common structural features exposed in misfolded proteins rather than specific sequences, but our understanding remains incomplete. These approaches could reveal whether Der1 has preferences for certain types of structural abnormalities or collaborates with other factors for substrate selection.

How conserved is Der1 function across species, and what insights can be gained from studying Der1 homologs in higher eukaryotes?

Der1 function appears to be conserved across eukaryotes, with mammals possessing multiple Der1 homologs (Derlin-1, Derlin-2, and Derlin-3) that likely evolved through gene duplication and functional specialization. Comparative studies can provide valuable insights:

  • Complementation Assays: Test whether human Derlins can rescue der1Δ yeast phenotypes, and if so, which domains are responsible for the conserved functionality. This approach can identify evolutionarily conserved functional regions.

  • Substrate Specificity Comparison: Compare the substrate range of yeast Der1 with mammalian Derlins to determine if substrate recognition mechanisms are conserved or have diverged.

  • Interactome Analysis: Compare the protein interaction networks of Der1 and its homologs across species using affinity purification-mass spectrometry to identify conserved and species-specific interaction partners.

  • Structure-Function Studies: Use structural biology approaches to compare the three-dimensional structures of Der1 homologs, potentially revealing conserved structural features critical for function.

  • Disease-associated Mutations: Study how mutations in human Derlins associated with diseases affect protein function, and attempt to model these mutations in yeast Der1 to establish a simpler experimental system.

The expanded Derlin family in mammals suggests functional specialization, with evidence indicating that different Derlins may handle distinct classes of ERAD substrates. Understanding this evolution could provide insights into how protein quality control systems adapted to meet the increased complexity of the mammalian proteome.

What role might Der1 play in responding to specific cellular stresses, and how can this be experimentally addressed?

Der1's potential role in stress response pathways is an emerging area of investigation, particularly given its connection to longevity . To explore Der1's function under various stress conditions, researchers could:

  • Stress-specific Transcriptional and Translational Regulation: Use RNA-seq and ribosome profiling to examine how different stressors affect DER1 expression and translation. This can reveal whether DER1 is specifically regulated during certain stress responses.

  • Conditional Der1 Mutants: Develop temperature-sensitive or chemically-controllable Der1 variants to study the immediate consequences of Der1 inactivation under different stress conditions.

  • Stress Survival Assays: Compare survival rates of wild-type and der1Δ strains under various stresses (oxidative, thermal, chemical, nutrient limitation) to identify specific conditions where Der1 function becomes critical.

  • Stress-induced Relocalization: Use fluorescently-tagged Der1 to monitor its subcellular localization during stress, potentially revealing stress-specific changes in distribution or complex formation.

  • Interaction with Stress Response Pathways: Investigate genetic and physical interactions between Der1 and components of major stress response pathways (UPR, heat shock response, oxidative stress response) through genetic screens and protein-protein interaction studies.

Preliminary data suggests that Der1 might have specialized roles during ER stress conditions, potentially helping to clear specific stress-induced misfolded proteins. Its contribution to longevity when deleted hints at complex relationships with cellular stress adaptation mechanisms that warrant further investigation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.