Recombinant Saccharomyces cerevisiae Delta (14)-sterol reductase

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ERG24; YNL280C; N0593; Delta(14-sterol reductase; C-14 sterol reductase; Sterol C14-reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-438
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
ERG24
Target Protein Sequence
MVSALNPRTTEFEFGGLIGALGISIGLPVFTIILNQMIRPDYFIKGFFQNFDIVELWNGI KPLRYYLGNRELWTVYCLWYGILAVLDVILPGRVMKGVQLRDGSKLSYKINGIAMSTTLV LVLAIRWKLTDGQLPELQYLYENHVSLCIISILFSFFLATYCYVASFIPLIFKKNGNGKR EKILALGGNSGNIIYDWFIGRELNPRLGPLDIKMFSELRPGMLLWLLINLSCLHHHYLKT GKINDALVLVNFLQGFYIFDGVLNEEGVLTMMDITTDGFGFMLAFGDLSLVPFTYSLQAR YLSVSPVELGWVKVVGILAIMFLGFHIFHSANKQKSEFRQGKLENLKSIQTKRGTKLLCD GWWAKSQHINYFGDWLISLSWCLATWFQTPLTYYYSLYFATLLLHRQQRDEHKCRLKYGE NWEEYERKVPYKIIPYVY
Uniprot No.

Target Background

Function

Reduces the C14=C15 double bond of 4,4-dimethyl-cholesta-8,14,24-trienol to produce 4,4-dimethyl-cholesta-8,24-dienol.

Database Links

KEGG: sce:YNL280C

STRING: 4932.YNL280C

Protein Families
ERG4/ERG24 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Delta(14)-sterol reductase and what reaction does it catalyze in the sterol biosynthesis pathway?

Delta(14)-sterol reductase (EC 1.3.1.70) is an enzyme that catalyzes the reduction of the C-14 double bond in sterol intermediates during ergosterol biosynthesis in yeast and cholesterol biosynthesis in mammals. Specifically, it catalyzes the chemical reaction:

4,4-dimethyl-5alpha-cholesta-8,14,24-trien-3beta-ol + NADPH + H+ → 4,4-dimethyl-5alpha-cholesta-8,24-dien-3beta-ol + NADP+

This enzyme belongs to the family of oxidoreductases, specifically those acting on the CH-CH group of donor with NAD+ or NADP+ as acceptor . In Saccharomyces cerevisiae, this enzyme is encoded by the ERG24 gene and plays a critical role in the ergosterol biosynthetic pathway, which is essential for fungal membrane integrity and cell viability .

How are Delta(14)-sterol reductases structurally related to other sterol reductases?

Delta(14)-sterol reductase shares significant structural similarities with other members of the sterol reductase family. Hydropathy analysis reveals that these enzymes typically contain multiple transmembrane domains. The protein has highly conserved amino acid sequence segments with other sterol reductases, including plant Δ7-sterol reductase and the human lamin B receptor (LBR) .

Key structural relationships include:

  • 35-38% sequence identity and 53-56% similarity to the carboxy-terminal sterol reductase domain of lamin B receptors from human, rat, Xenopus, and chicken

  • Significant homology (28-39% identity) to sterol C-14 reductases from various fungi including Ascobolus, Schizosaccharomyces pombe, Nectria haematococca, Neurospora, and Septoria lycopersici

  • Similar hydropathy plots and conserved catalytic scaffolds that facilitate identical reactions in substrates differing only in the position of the double bond

These structural relationships suggest that different sterol reductases evolved from common ancestral proteins, with the Δ7-sterol reductase in multicellular organisms likely evolving from the Δ14-sterol reductases of unicellular ancestors .

What in vitro assay systems can be used to measure Delta(14)-sterol reductase activity?

An effective in vitro assay for Delta(14)-sterol reductase from yeast has been developed using ergosta-8,14-dien-3beta-ol as the substrate . The general methodology includes:

  • Enzyme preparation: Microsomes isolated from yeast cells expressing ERG24

  • Reaction components:

    • Substrate: ergosta-8,14-dien-3beta-ol

    • Cofactor: NADPH (essential for activity)

    • Buffer system: Typically phosphate buffer at pH 7.0-7.5

  • Detection methods:

    • Gas chromatography/Mass spectrometry (GC/MS) to analyze sterol conversion

    • Radioisotope labeling of substrates for quantitative analysis

When setting up the assay, researchers should consider:

  • Optimal protein concentration and incubation time

  • Temperature (usually 30°C for yeast enzymes)

  • Controls including heat-inactivated enzyme and no-NADPH controls

  • Solubilization methods for the hydrophobic sterol substrates

The enzyme exhibits Michaelis-Menten kinetics, and researchers can determine kinetic parameters (Km, Vmax) using varying substrate concentrations . This assay system is particularly valuable for studying enzyme inhibitors such as antimycotic azasterols.

How can yeast complementation assays be designed to evaluate the functionality of recombinant Delta(14)-sterol reductase?

Yeast complementation assays provide a powerful approach to assess the functionality of recombinant Delta(14)-sterol reductase. The methodology involves:

  • Strain selection: Use an ERG24-deficient S. cerevisiae strain (erg24 null mutant), which typically shows:

    • Accumulation of Δ8,14 sterols with two double bonds at carbon positions 8 and 14

    • Calcium dependency for growth (unable to grow on calcium-depleted medium)

    • Altered ergosterol biosynthesis

  • Vector construction:

    • Clone the gene of interest (e.g., human LBR or plant FK) into a yeast expression vector

    • Include appropriate promoter and terminator sequences

    • Incorporate selection markers (e.g., URA3)

  • Transformation and selection:

    • Transform erg24 null mutant cells with the expression vector

    • Select transformants on appropriate media

    • Verify expression of the recombinant protein by Western blotting

  • Functional assessment:

    • Growth assays: Compare growth of transformants under permissive (calcium-rich) and non-permissive (calcium-poor) conditions

    • Sterol profile analysis: Extract and analyze sterols by GC/MS to determine if the wild-type sterol profile is restored

    • Measure ergosterol production to confirm restoration of the biosynthetic pathway

For example, when human LBR or Arabidopsis FK cDNA was expressed in erg24 cells, both restored growth in calcium-depleted medium and rescued the ergosterol biosynthesis defect, demonstrating that these proteins can function as sterol C-14 reductases in yeast .

How can recombinant Delta(14)-sterol reductase be used to study sterol reductase inhibitors and antimycotic agents?

Recombinant Delta(14)-sterol reductase provides an excellent tool for studying sterol reductase inhibitors and developing antimycotic agents through the following approaches:

  • Construction of specialized yeast strains:

    • Engineer strains like EMY54, which lack both sterol C8-C7 isomerase and sterol C14 reductase activities, making them ergosterol-requiring

    • Transform these strains with vectors expressing either yeast ERG24 or other C14 reductases like human LBR

  • Inhibitor screening methodology:

    • Growth inhibition assays: Measure growth of transformed yeast in sterol-free medium with various inhibitor concentrations

    • Biochemical assays: Directly measure enzyme activity in the presence of inhibitors using the in vitro assay system

    • Sterol profile analysis: Analyze accumulation of specific sterol intermediates when inhibitors are present

  • Inhibitor characterization:

    • Determine IC50 values (e.g., fenpropimorph: highly effective; tridemorph: highly effective; SR 31747: moderately effective against LBR-produced enzyme)

    • Analyze structure-activity relationships

    • Compare inhibition patterns between different species' enzymes

  • Validation in various systems:

    • Compare inhibition in purified recombinant enzyme versus whole-cell systems

    • Test cross-species inhibition patterns to identify selective inhibitors

Research has shown that sterol biosynthesis and proliferation of LBR-producing yeast cells are highly susceptible to antimycotic compounds like fenpropimorph and tridemorph, while showing moderate susceptibility to SR 31747 . The 15-azasterol class of antimycotics has been verified to inhibit the Delta(14)-sterol reductase, causing accumulation of ergosta-8,14-dien-3beta-ol in yeast cultures .

What approaches can resolve conflicting data on the functional relationship between human lamin B receptor (LBR) and Delta(14)-sterol reductase activity?

Resolving conflicting data regarding the functional relationship between human lamin B receptor (LBR) and Delta(14)-sterol reductase activity requires multi-faceted approaches:

  • Domain-specific functional analysis:

    • Generate constructs expressing only the sterol reductase domain of LBR

    • Create chimeric proteins with domains from confirmed C14-sterol reductases

    • Perform site-directed mutagenesis of conserved residues to identify critical catalytic elements

  • Comparative enzymatic characterization:

    • Directly compare enzyme kinetics and substrate specificity between LBR and dedicated C14-sterol reductases like DHCR14

    • Analyze reaction products using mass spectrometry to confirm identical catalytic activities

    • Test both enzymes under identical conditions with various sterol substrates

  • Cellular localization and interaction studies:

    • Determine if the nuclear localization of LBR affects its sterol reductase activity

    • Identify potential protein-protein interactions that might regulate activity

    • Examine membrane topology and subcellular compartmentalization

  • Tissue-specific expression analysis:

    • Compare expression patterns of LBR and DHCR14 across tissues

    • Determine if they show complementary expression (one enzyme or the other predominates in specific tissues)

    • Analyze whether their expression patterns correlate with sterol reductase activity needs

Research has shown that human LBR can complement erg24 mutations in yeast, restoring sterol C14 reduction and ergosterol prototrophy, while DHCR14 cannot complement this deficiency under the same conditions . This suggests functional differences between these enzymes despite their structural similarities. Additionally, gene expression data across human tissues reveals a negative relationship between the C14-sterol reductases; one enzyme or the other tends to be predominantly expressed in each tissue .

How do post-translational modifications and regulatory mechanisms affect Delta(14)-sterol reductase activity?

The regulation of Delta(14)-sterol reductase involves sophisticated post-translational mechanisms that fine-tune enzyme activity in response to cellular needs:

  • Sterol-dependent protein turnover:

    • DHCR14 (human Delta(14)-sterol reductase) undergoes rapid turnover triggered by cholesterol and other sterol intermediates

    • LBR (lamin B receptor with C14-sterol reductase activity) remains relatively stable regardless of sterol levels

    • Multiple sterol intermediates from the mevalonate pathway, including MASs (methylated sterol intermediates), can trigger DHCR14 degradation

  • Ubiquitin-proteasome system (UPS) involvement:

    • DHCR14 is degraded via the ubiquitin-proteasome system

    • Several E3 ligases have been identified that modulate DHCR14 levels

    • Proteasome inhibitors can stabilize the enzyme, allowing for experimental manipulation of protein levels

  • Transcriptional regulation differences:

    • Yeast ERG24 is regulated by ergosterol levels

    • Human TM7SF2 (DHCR14) shows sterol-dependent transcriptional regulation in some cell lines, with mRNA increasing during sterol depletion (statin treatment) and decreasing with high sterol levels

    • LBR is not responsive to cellular sterol levels at the transcriptional level

  • Tissue-specific expression patterns:

    • A negative relationship exists between expression of the two human C14-sterol reductases (LBR and DHCR14)

    • One enzyme or the other tends to be predominantly expressed in each tissue

This differential regulation suggests that while LBR serves as a constitutively active C14-sterol reductase, DHCR14 levels are tunable, responding to local cellular demands for cholesterol . This regulatory divergence may explain the evolutionary maintenance of two enzymes with overlapping functions.

What are the structural determinants of substrate specificity in Delta(14)-sterol reductase compared to other sterol reductases?

The structural determinants of substrate specificity in Delta(14)-sterol reductase and its comparison to other sterol reductases reveal important insights into their evolutionary relationships and functional mechanisms:

  • Transmembrane domain organization:

    • Delta(14)-sterol reductase contains multiple transmembrane segments (6-9 putative transmembrane α-helices)

    • These transmembrane regions form a hydrophobic pocket that accommodates the sterol substrate

    • The spatial arrangement of these helices differs between reductases acting on different positions

  • Conserved catalytic residues:

    • Several highly conserved amino acid sequence segments exist across different sterol reductases

    • These conserved regions in the Delta(14)-sterol reductase align with similar regions in:

      • Δ7-sterol reductases from plants and mammals

      • Sterol C-24(28) reductases from yeast

      • The carboxy-terminal domain of lamin B receptors

  • Cofactor binding sites:

    • All sterol reductases require NADPH as a cofactor

    • They share a common reaction mechanism involving:

      • Formation of a short-lived carbocationic reaction intermediate

      • Enzyme-mediated protonization

      • Hydride ion transfer from NADPH

  • Evolutionary adaptations:

    • Similar hydropathy plots and conserved amino acid sequence segments suggest that the same protein platforms and catalytic scaffolds are used to catalyze identical reactions in substrates differing only in the position of the double bond

    • Δ7-sterol reductase in multicellular organisms likely evolved from the Δ14-sterol reductases of unicellular ancestors

    • Yeast lacks Δ7-sterol reductase activity, highlighting the evolutionary divergence of these enzymes

Understanding these structural determinants has significant implications for rational design of selective inhibitors targeting specific sterol reductases, which could lead to the development of targeted antifungal agents with minimal cross-reactivity to human enzymes.

How does the function of Delta(14)-sterol reductase differ between yeast, plants, and mammals?

Delta(14)-sterol reductase function varies significantly across evolutionary lineages, revealing both conservation of core enzymatic mechanisms and adaptation to specific biological requirements:

  • Yeast (Saccharomyces cerevisiae):

    • ERG24 encodes the Delta(14)-sterol reductase essential for ergosterol biosynthesis

    • Deficiency causes accumulation of Δ8,14 sterols and calcium dependency

    • Serves as a single dedicated enzyme for C14-sterol reduction

    • Critical for membrane integrity and cell wall formation

  • Plants (e.g., Arabidopsis):

    • The FACKEL (FK) gene encodes a functional Delta(14)-sterol reductase

    • Essential for embryonic development and cell division in Arabidopsis

    • Mutations cause severe defects in cell organization and patterning

    • Plant FK can functionally complement yeast erg24 mutants, demonstrating conservation of enzyme function

  • Mammals (humans and other vertebrates):

    • Two distinct proteins can perform C14-sterol reduction:

      • Transmembrane 7 superfamily member 2 (TM7SF2/DHCR14): A dedicated sterol reductase

      • Lamin B Receptor (LBR): A bifunctional protein with both nuclear envelope and sterol reductase functions

    • Differential regulation: DHCR14 undergoes sterol-dependent turnover while LBR remains stable

    • Tissue-specific expression patterns with one enzyme typically predominating in each tissue

    • LBR plays critical roles in neutrophil differentiation and nuclear lobulation

  • Functional consequences of differences:

    • In mammals, LBR deficiency causes Pelger-Huët anomaly (abnormal nuclear morphology in neutrophils)

    • The sterol Δ14 reductase domain of LBR is essential for both myeloid cell growth and functional maturation

    • Expression of just the C-terminal sterol reductase domain of LBR can rescue certain phenotypes in LBR-deficient cells

This cross-species comparison reveals how a fundamental metabolic enzyme has evolved additional functions in complex organisms, particularly in mammals where the dual functionality of LBR connects sterol metabolism with nuclear architecture.

What insights can comparative analysis of Delta(14)-sterol reductase sequences provide for understanding enzyme evolution in the sterol biosynthetic pathway?

Comparative analysis of Delta(14)-sterol reductase sequences across species offers profound insights into enzyme evolution within the sterol biosynthetic pathway:

  • Phylogenetic relationships:

    • Delta(14)-sterol reductases form a distinct clade within the sterol reductase family

    • Significant identities (38%-34%) and similarities (56%-53%) exist between fungal ERG24 and the 400 amino acid carboxy-terminal sterol reductase domain of mammalian lamin B receptors

    • Plant FK (FACKEL) proteins show homology to both mammalian and fungal C14-sterol reductases, suggesting conservation of this enzymatic function throughout eukaryotic evolution

  • Domain architecture and functional divergence:

    • Yeast and plant Delta(14)-sterol reductases exist as dedicated enzymes

    • In mammals, the enzyme function exists in both a dedicated form (DHCR14/TM7SF2) and as part of a bifunctional protein (LBR)

    • The fusion of sterol reductase with nuclear envelope-binding domains in LBR represents an evolutionary innovation connecting sterol metabolism with nuclear architecture

  • Reaction mechanism conservation:

    • All Delta(14)-sterol reductases use NADPH as a cofactor

    • They share a common reaction mechanism involving the formation of a carbocationic intermediate, enzyme-mediated protonization, and hydride transfer from NADPH

    • This conservation suggests ancient origins of the catalytic mechanism

  • Evolutionary relationships with other sterol reductases:

    • Delta(14)-sterol reductases share structural similarities with:

      • Delta(7)-sterol reductases (essential for final steps of cholesterol biosynthesis)

      • C-24(28) reductases (involved in side-chain modifications)

    • The absence of Delta(7)-sterol reductase in yeast, coupled with its presence in multicellular organisms, suggests that this enzyme evolved from Delta(14)-sterol reductases in unicellular ancestors

  • Substrate specificity evolution:

    • Similar protein platforms and catalytic scaffolds are used to catalyze identical reactions in substrates differing only in the position of the double bond

    • This suggests that gene duplication followed by specialization was a key mechanism in the evolution of the sterol biosynthetic pathway

This evolutionary analysis not only illuminates the history of sterol metabolism but also provides insights for rational enzyme engineering and the development of species-selective inhibitors targeting specific branches of the sterol biosynthetic pathway.

What expression systems are most effective for producing active recombinant Saccharomyces cerevisiae Delta(14)-sterol reductase?

Several expression systems can be employed for producing active recombinant S. cerevisiae Delta(14)-sterol reductase, each with distinct advantages and limitations:

  • Escherichia coli:

    • Advantages: Rapid growth, high protein yields, simple genetics

    • Considerations:

      • Requires careful optimization for membrane protein expression

      • Often requires fusion tags to improve solubility

      • May form inclusion bodies requiring refolding

    • Recommended approach: Express with N-terminal His tag in E. coli strains specialized for membrane proteins (e.g., C41(DE3) or C43(DE3))

    • Purification yield: Can achieve >85% purity with appropriate chromatography methods

  • Yeast expression systems:

    • Advantages: Native-like environment, proper folding and post-translational modifications

    • Systems:

      • Homologous expression in S. cerevisiae (especially in erg24Δ strains)

      • Pichia pastoris for higher yields

    • Strategy: Expression under control of strong inducible promoters (GAL1, AOX1)

    • Verification: Functional complementation of erg24 mutants provides immediate confirmation of activity

  • Insect cell/Baculovirus:

    • Advantages: Higher eukaryotic environment, good for complex membrane proteins

    • Considerations: Requires baculovirus generation, longer production time

    • Yield: Generally produces functional protein with proper folding

  • Mammalian cell expression:

    • Advantages: Most native-like environment for mammalian homologs

    • Limitations: Lower yields, higher cost, longer production time

    • Best used for: Comparative studies with mammalian sterol reductases

  • Cell-free expression:

    • Advantages: Rapid production, directly accessible reaction conditions

    • Considerations: May require specialized detergents or lipid environments

    • Best for: Mechanistic studies requiring rapid mutation screening

Optimal conditions for active enzyme:

  • Maintain in detergent micelles (DDM, LMNG) or lipid nanodiscs to preserve activity

  • Include lipids from yeast membranes to enhance stability

  • Consider co-expression with yeast chaperones to improve folding

  • Purify in the presence of NADPH to stabilize the active site

The choice of expression system should be guided by the specific research goals. For structural studies requiring large amounts of pure protein, E. coli or P. pastoris may be preferred. For functional studies, S. cerevisiae expression with complementation assays offers the most physiologically relevant system .

What are the most reliable methods for assessing the purity and activity of recombinant Delta(14)-sterol reductase preparations?

Ensuring the purity and activity of recombinant Delta(14)-sterol reductase preparations requires a systematic approach utilizing both biochemical and functional assays:

  • Purity assessment methods:

    • SDS-PAGE analysis:

      • Standard method achieving >85% purity visualization

      • Silver staining for higher sensitivity detection of contaminants

      • Western blotting with anti-His tag or specific antibodies for identity confirmation

    • Size exclusion chromatography (SEC):

      • Evaluates monodispersity and aggregation state

      • Can identify different oligomeric states

      • Useful for quality control between different preparations

    • Mass spectrometry:

      • Peptide mass fingerprinting for identity confirmation

      • Intact mass analysis for post-translational modification detection

      • Useful for detecting truncations or modifications

  • Activity assessment methods:

    • In vitro enzymatic assays:

      • Using ergosta-8,14-dien-3beta-ol as substrate

      • Monitoring NADPH consumption spectrophotometrically at 340 nm

      • Analyzing reaction products by GC/MS

      • Determining kinetic parameters (Km, Vmax, kcat)

    • Functional complementation:

      • Transformation of erg24 null mutant yeast

      • Growth assessment on calcium-depleted medium

      • Quantitative growth curves to measure activity levels

    • Sterol profile analysis:

      • Extraction of sterols from complemented yeast

      • GC/MS analysis to verify conversion of sterol intermediates

      • Quantification of ergosterol production

  • Enzyme stability assessment:

    • Thermal shift assays:

      • Measures protein unfolding in response to temperature

      • Can identify stabilizing buffer conditions

      • Useful for quality control between batches

    • Activity retention over time:

      • Measure activity after storage at different temperatures

      • Evaluate freeze-thaw stability

      • Recommended storage in Tris/PBS-based buffer with 6% trehalose at pH 8.0

  • Inhibitor sensitivity profiling:

    • Test sensitivity to known inhibitors (e.g., 15-azasterol, fenpropimorph)

    • Compare IC50 values with literature data

    • Serves as fingerprint for proper enzyme folding and activity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.