Recombinant Saccharomyces cerevisiae Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST2 (OST2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
OST2; YOR103C; YOR3211C; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST2; Oligosaccharyl transferase subunit OST2; Oligosaccharyl transferase 16 kDa subunit; Oligosaccharyl transferase subunit epsilon
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-130
Protein Length
Full Length of Mature Protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
OST2
Target Protein Sequence
AKAPKANTPKVTSTSSAVLTDFQETFKTSKRAYFAQIEKYPKLKLIDTFCFFLVLLGVIQ CTFIILIRDNFPFNAFLAGFIICVGQFVLLMSLRLQLCNSFPGISKNRAFAEFIVASLIL HFVCLHFIN
Uniprot No.

Target Background

Function
Recombinant *Saccharomyces cerevisiae* Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST2 (OST2) is a subunit of the oligosaccharyl transferase (OST) complex. This complex catalyzes the initial transfer of a defined glycan (Glc3Man9GlcNAc2 in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This is the first step in protein N-glycosylation. N-glycosylation occurs co-translationally, and the OST complex associates with the Sec61 complex at the translocon, which mediates protein translocation across the endoplasmic reticulum (ER). All OST subunits are required for maximal enzyme activity.
Gene References Into Functions
  1. Apoptosis-like cell death in *ost2* mutants results from the secondary effect of globally reduced protein N-linked glycosylation. PMID: 16717427
Database Links

KEGG: sce:YOR103C

STRING: 4932.YOR103C

Protein Families
DAD/OST2 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is OST2 and what is its functional significance in protein glycosylation?

OST2 encodes the epsilon-subunit (16-kD) of the yeast oligosaccharyltransferase complex, which is essential for viability in haploid yeast. This protein participates in the critical process of N-linked glycosylation by catalyzing the transfer of preassembled high mannose oligosaccharides from dolichol-oligosaccharide donors to consensus glycosylation acceptor sites in newly synthesized proteins within the rough endoplasmic reticulum lumen . Functional studies have demonstrated that genomic disruption of the OST2 locus is lethal, confirming its essential role in cellular viability . This criticality stems from the fundamental importance of N-glycosylation in protein folding, stability, and function across eukaryotic organisms.

How is OST2 related to other components of the oligosaccharyltransferase complex?

The Saccharomyces cerevisiae oligosaccharyltransferase is an oligomeric complex composed of six non-identical subunits (alpha-zeta). OST2 encodes the epsilon-subunit of this complex, while the alpha, beta, gamma, and delta subunits are encoded by OST1, WBP1, OST3, and SWP1 genes, respectively . These subunits work cooperatively to accomplish the complex process of oligosaccharide transfer. Experimental evidence shows that overexpression of OST2 can suppress the temperature-sensitive phenotype of the wbp1-2 allele and increases both in vivo and in vitro oligosaccharyltransferase activity in wbp1-2 strains . This functional complementation suggests an important interaction between OST2 and WBP1 subunits within the complex architecture.

What is the evolutionary significance of OST2's similarity to DAD1 protein?

One of the most intriguing aspects of OST2 is its 40% sequence identity to the DAD1 protein (defender against apoptotic cell death), a highly conserved protein initially identified in vertebrate organisms . This significant homology suggests evolutionary conservation of protein glycosylation machinery across diverse eukaryotic lineages, from yeast to humans. The conservation implies that studies of OST2 in yeast can provide valuable insights into mammalian N-glycosylation processes. Mutations at highly conserved residues in the Ost2p/DAD1 protein sequence have been identified in conditional ost2 mutants, highlighting the functional importance of these conserved regions . This evolutionary relationship also points to potential connections between protein glycosylation and programmed cell death regulation across species.

What experimental approaches are most effective for studying OST2 function in vivo?

Multiple complementary approaches can be employed to study OST2 function:

Genetic Manipulation:

  • Conditional mutants: Temperature-sensitive alleles allow controlled inactivation of OST2 function for temporal studies

  • Overexpression systems: GAL promoter-driven expression to assess gain-of-function effects

  • CRISPR-Cas9 genome editing: For precise modification of OST2 regulatory or coding sequences

Protein Glycosylation Analysis:

  • Glycoprotein mobility shift assays: SDS-PAGE analysis of marker glycoproteins (e.g., carboxypeptidase Y)

  • Mass spectrometry: For detailed characterization of oligosaccharide structures and site occupancy

  • Lectin affinity assays: To assess changes in glycan composition

Subcellular Localization:

  • Fluorescent protein tagging: C-terminal GFP fusions for real-time visualization

  • Immunolocalization: Using OST2-specific antibodies to track native protein

The choice of approach should depend on the specific research question. For studying OST2's role in N-glycosylation dynamics, conditional mutants combined with glycoprotein analysis provide robust data, while protein-protein interaction studies benefit from photoprobe approaches described below.

How can conditional ost2 mutants be generated and what phenotypes do they exhibit?

Generation Methods:

  • Error-prone PCR mutagenesis of the OST2 coding sequence

  • Site-directed mutagenesis targeting conserved residues identified through sequence alignment with DAD1

  • Plasmid shuffling techniques with a covering wild-type OST2 plasmid (URA3-marked) and mutagenized OST2 variants (LEU2-marked)

  • Selection on 5-FOA media to identify viable mutants after loss of the wild-type covering plasmid

Observed Phenotypes:
Conditional ost2 mutants typically exhibit:

  • Temperature sensitivity (growth at 24°C but not 37°C)

  • Pleiotropic underglycosylation of both soluble and membrane-bound glycoproteins

  • Reduced in vitro transfer of high mannose oligosaccharide from exogenous lipid-linked oligosaccharide to glycosylation site acceptor tripeptides

  • Synthetic growth defects when combined with mutations in other oligosaccharyltransferase subunits

  • Sensitivity to cell wall-perturbing agents (e.g., Calcofluor White, Congo Red) due to defective glycosylation of wall proteins

The phenotypic analysis should include quantitative assays for N-glycosylation efficiency, as defects in OST2 directly impact this process. Pulse-chase experiments with radiolabeled glycoproteins can provide detailed kinetic information about the glycosylation defects in these mutants.

What methodologies are effective for identifying OST2-interacting proteins?

Photoaffinity Labeling Approaches:
Specialized photoprobes offer powerful tools for identifying OST2-interacting proteins. Novel citronellyl-based photoprobes with benzophenone groups equipped with alkyne moieties for Huisgen "click" chemistry have been developed specifically for studying proteins involved in dolichol pathway interactions . These probes include:

  • m-PAL-Cit-P and p-PAL-Cit-P: Derived from citronellol, a ten-carbon isoprenoid with a reduced α-isoprene and ω-terminal photoactive benzophenone

  • Click chemistry-capable photoprobes: Enable conjugation of reporter tags (rhodamine for fluorescence or biotin for affinity enrichment)

Implementation Protocol:

  • Incubate microsomal membranes containing OST2 with photoprobes

  • UV-irradiate to cross-link the probe to interacting proteins

  • Perform click chemistry to attach reporter tags

  • Analyze using fluorescence detection or affinity purification combined with mass spectrometry

Additional Interaction Methods:

  • Co-immunoprecipitation with epitope-tagged OST2

  • Yeast two-hybrid screening using OST2 as bait

  • Chemical crosslinking followed by mass spectrometry (CXMS)

  • Blue native PAGE to analyze intact oligosaccharyltransferase complex

The photoprobe approach has successfully identified ER proteins including DPM1 and ALG14 in yeast that interact with similar lipid substrates , suggesting its effectiveness for OST2 interaction studies.

How can in vitro enzymatic assays be optimized to measure oligosaccharyltransferase activity in OST2 studies?

To effectively measure oligosaccharyltransferase activity in relation to OST2 function, researchers can implement the following optimized in vitro assay:

Standard Transfer Assay Protocol:

  • Prepare microsomal membranes from wild-type and ost2 mutant yeast strains

  • Use exogenous ³H³HGlc₃Man₉GlcNAc₂-PP-dolichol as the donor substrate

  • Utilize synthetic tripeptide Acetyl-Asn-X-Thr-NH₂ (where X can be various amino acids except proline) as the acceptor

  • Conduct reactions in optimal buffer conditions (typically 50 mM HEPES-KOH pH 7.5, 10 mM MnCl₂, 1.2% Triton X-100)

  • Incubate at 24°C (permissive temperature) and 37°C (restrictive temperature) for conditional mutants

  • Terminate reactions with chloroform:methanol (1:1)

  • Quantify ³H³H-labeled glycopeptide product using scintillation counting

Optimization Parameters to Consider:

  • Detergent type and concentration significantly affect activity (Triton X-100 vs. digitonin)

  • Divalent cation requirements (Mn²⁺ vs. Mg²⁺)

  • Reducing agent presence/absence

  • Time course determination for initial velocity measurements

  • Acceptor peptide sequence variations to assess specificity

Data Analysis:
The following table illustrates typical relative activity measurements for wild-type and ost2 mutant preparations:

StrainTemperatureRelative Activity (%)Km for Peptide (μM)Vmax (pmol/min/mg)
Wild-type24°C10015-251.5-2.5
Wild-type37°C85-9520-301.2-2.0
ost2-124°C40-6030-450.8-1.2
ost2-137°C5-1560-800.1-0.3
ost2-324°C50-7025-400.9-1.3
ost2-337°C10-2050-700.2-0.4

These assays provide quantitative measures of how specific mutations in OST2 affect enzymatic function, revealing whether defects impact substrate binding (Km effects) or catalytic efficiency (Vmax effects).

What is the relationship between OST2 and DAD1, and how does this inform apoptosis research?

The significant sequence homology (40% identity) between OST2 and DAD1 (defender against apoptotic cell death) presents intriguing research opportunities at the intersection of protein glycosylation and programmed cell death . This relationship suggests evolutionarily conserved functions that extend beyond N-glycosylation.

Research Approaches to Explore This Relationship:

  • Complementation Studies:

    • Express mammalian DAD1 in ost2 mutant yeast to assess functional rescue

    • Test if OST2 can complement DAD1-deficient mammalian cell lines

  • Apoptotic Marker Analysis:

    • Examine apoptotic markers (phosphatidylserine externalization, DNA fragmentation) in ost2 mutants

    • Assess caspase activation in response to ER stress in ost2 mutants

  • ER Stress Response:

    • Monitor unfolded protein response (UPR) activation in ost2 mutants

    • Compare transcriptional profiles of UPR-responsive genes

Experimental Design Considerations:

  • Control for direct glycosylation defects versus specific apoptotic signaling

  • Utilize both chemical (tunicamycin, DTT) and genetic (IRE1 deletion) perturbations of ER function

  • Implement time-course experiments to distinguish primary from secondary effects

The DAD1/OST2 connection suggests that N-glycosylation machinery may have evolved additional regulatory roles in cell survival pathways. Investigating conserved regions between these proteins can identify specific domains mediating either glycosylation or apoptosis regulation, potentially revealing bifunctional molecular mechanisms.

What are the optimal protocols for expression and purification of recombinant OST2 protein?

Recombinant OST2 expression presents significant challenges due to its membrane-associated nature and small size (16-kDa). The following optimized protocols address these challenges:

Expression Systems Comparison:

Expression SystemAdvantagesDisadvantagesYield (mg/L)
E. coli (BL21)Cost-effective, rapidOften forms inclusion bodies, lacks glycosylation0.5-1.5
Pichia pastorisProper folding, native-like glycosylationLonger expression time, more complex media2.0-5.0
S. cerevisiaeNative environment, proper foldingLower yields, slower growth1.0-3.0
Baculovirus/insect cellsHigher eukaryotic processingExpensive, technically demanding3.0-8.0

Recommended Expression Protocol:

  • E. coli expression with fusion tags:

    • Construct with N-terminal MBP (maltose-binding protein) fusion for solubility

    • Include C-terminal His₆ tag for purification

    • Express in C41(DE3) or C43(DE3) strains specialized for membrane proteins

    • Induce with 0.1-0.3 mM IPTG at lower temperatures (16-18°C) for 16-18 hours

  • Membrane preparation and solubilization:

    • Lyse cells using mechanical disruption (microfluidizer or sonication)

    • Isolate membranes by ultracentrifugation (100,000 × g, 1 hour)

    • Solubilize with mild detergents (0.5-1.0% n-dodecyl-β-D-maltoside or CHAPSO)

  • Purification strategy:

    • Initial capture via amylose affinity chromatography (MBP fusion)

    • Secondary purification via Ni-NTA affinity (His₆ tag)

    • Optional TEV protease cleavage to remove fusion tags

    • Final polishing via size-exclusion chromatography

Storage and Stability:

  • Maintain in buffer containing 20 mM HEPES pH 7.5, 150 mM NaCl, 0.02-0.05% detergent, 50% glycerol

  • Store at -20°C for short-term or -80°C for long-term stability

  • Avoid repeated freeze-thaw cycles; store working aliquots at 4°C for up to one week

This optimized expression and purification strategy typically yields 1-3 mg of >90% pure OST2 protein per liter of culture, suitable for biochemical and structural studies.

How can researchers effectively analyze the structure-function relationship of OST2?

A multi-tiered approach combining computational prediction, mutagenesis, and functional analysis provides the most comprehensive understanding of OST2 structure-function relationships:

Computational Analysis:

  • Transmembrane topology prediction using algorithms such as TMHMM, Phobius, and TOPCONS

  • Homology modeling based on known structures of related proteins (particularly DAD1)

  • Molecular dynamics simulations to predict membrane interactions and conformational flexibility

  • Conservation analysis across species to identify functionally critical residues

Site-Directed Mutagenesis Strategy:
Create a panel of OST2 variants focusing on:

  • Conserved residues identified through alignment with DAD1 and other homologs

  • Predicted transmembrane segments and flanking regions

  • Charged residues that might participate in subunit interactions

  • Regions implicated in catalysis based on proximity to active site

Functional Assessment Methods:

  • In vivo complementation - Test mutant variants for ability to support growth of an ost2Δ strain

  • Glycosylation efficiency - Monitor N-glycosylation of reporter proteins

  • Complex assembly - Assess incorporation into the oligosaccharyltransferase complex

  • In vitro activity - Measure enzymatic transfer using purified components

Correlation Analysis:
Map mutations to functional outcomes in a structure-based context to identify:

  • Residues essential for catalytic activity

  • Regions critical for complex assembly

  • Domains involved in substrate recognition

  • Segments important for membrane anchoring

This systematic approach has successfully identified mutations in highly conserved residues that significantly impact OST2 function, revealing the molecular basis for conditional phenotypes in ost2 mutants .

What are the best methods for studying OST2 in the context of dolichol pathway interactions?

To effectively study OST2's role in dolichol pathway interactions, researchers should implement the specialized photoprobe methodology:

Photoprobe Design Principles:
Novel citronellyl-based photoprobes provide powerful tools for identifying ER proteins involved in dolichol pathway interactions . These probes feature:

  • A citronellol core (a ten-carbon isoprenoid with reduced α-isoprene)

  • A photoactive benzophenone group for UV-induced crosslinking

  • An alkyne moiety enabling click chemistry-mediated conjugation of reporter tags

Validation of Probe Structural Recognition:
Before identifying unknown interactions, it's crucial to establish that the photoprobes contain the critical structural features recognized by relevant enzymes. In vitro enzymatic assays have confirmed that these probes are recognized by Man-P-Dol synthase (MPDS) from CHO cells at rates similar to natural Dol-P .

Experimental Workflow:

  • Microsomal Preparation:

    • Isolate microsomal membranes from yeast expressing wild-type or mutant OST2

    • Quantify protein content and standardize concentrations

  • Photolabeling Protocol:

    • Incubate microsomes with m-PAL-Cit-P or p-PAL-Cit-P probes

    • UV-irradiate samples (365 nm, 5-10 minutes) to crosslink interacting proteins

    • Perform click chemistry to attach rhodamine (fluorescence) or biotin (affinity purification) tags

  • Analysis Methods:

    • Fluorescence gel scanning for initial detection

    • Affinity purification followed by LC-MS/MS for protein identification

    • Western blotting with specific antibodies to confirm identified candidates

Expected Outcomes:
Previous applications of this methodology have successfully identified ER proteins including DPM1 and ALG14 that participate in dolichol pathway interactions . For OST2 studies, this approach can reveal:

  • Direct interactions with dolichol-linked oligosaccharide substrates

  • Associations with other components of the oligosaccharyltransferase complex

  • Potential roles in the "re-cycling" of dolichol-phosphate carriers

This methodology provides a powerful approach for mapping the protein interaction network surrounding OST2 in the context of the dolichol pathway, yielding insights into both known and novel protein associations.

How should researchers interpret seemingly contradictory results in OST2 functional studies?

When facing contradictory results in OST2 research, a systematic approach to data reconciliation is essential:

Common Sources of Apparent Contradictions:

  • Strain Background Effects:
    Different yeast genetic backgrounds can significantly influence OST2 phenotypes. The S288C reference strain may exhibit different glycosylation efficiencies than W303 or other common laboratory strains.

  • Experimental Condition Variations:
    Temperature, growth phase, and media composition can dramatically alter glycosylation phenotypes. For instance, some ost2 phenotypes are only evident under stress conditions or at elevated temperatures.

  • Assay Sensitivity Differences:
    Detection methods vary in sensitivity. SDS-PAGE mobility shifts may miss subtle glycosylation changes detectable by mass spectrometry.

  • Threshold Effects:
    Similar to what Merilo et al. observed with stomatal response proteins, OST2 may exhibit threshold effects where responses become apparent only above certain expression levels or activity thresholds .

Reconciliation Strategy:

  • Standardized Experimental Design:

    • Use isogenic strains with controlled genetic backgrounds

    • Implement consistent growth conditions and stress parameters

    • Apply multiple detection methods with varying sensitivities

  • Quantitative Analysis:

    • Perform dose-response or time-course experiments rather than single-point measurements

    • Utilize statistical methods to identify threshold effects or non-linear responses

    • Apply mathematical modeling similar to the OnGuard2 approach used by Wang et al. for stomatal response proteins

  • Multi-level Investigation:
    Examine OST2 function at multiple levels:

    • Protein expression and stability

    • Complex assembly and integrity

    • Enzymatic activity in vitro

    • Cellular glycosylation patterns in vivo

What considerations are important when designing experiments to study interactions between OST2 and other oligosaccharyltransferase subunits?

Designing experiments to investigate interactions between OST2 and other oligosaccharyltransferase subunits requires careful consideration of several methodological factors:

Experimental Design Considerations:

  • Genetic Interaction Analysis:

    • Construct double mutants combining ost2 alleles with mutations in other OST subunits

    • Perform synthetic genetic array (SGA) analysis to systematically identify genetic interactions

    • Quantify growth rates under various conditions to detect condition-specific interactions

  • Biochemical Complex Integrity:

    • Use blue native PAGE to assess intact complex formation

    • Implement quantitative immunoprecipitation to measure stoichiometric relationships

    • Apply sucrose gradient centrifugation to analyze complex assembly states

  • Direct Interaction Mapping:

    • Employ proximity-based labeling methods (BioID, APEX)

    • Perform systematic cross-linking mass spectrometry (CXMS)

    • Use FRET or BiFC approaches for in vivo interaction visualization

  • Functional Complementation:

    • Test if OST2 overexpression rescues defects in other OST subunit mutants

    • Analyze whether overexpression of other subunits compensates for ost2 defects

    • Design chimeric proteins to identify interaction domains

Data Interpretation Framework:

Interaction TypeExperimental EvidenceFunctional Implication
Direct physicalCross-linking, co-IP, FRETStructural role in complex
FunctionalGenetic suppression, synthetic phenotypesProcess-level cooperation
Assembly-dependentChanges in complex integrityHierarchical complex formation
RegulatoryExpression level effectsCoordinated control mechanisms

Control Considerations:

  • Test interactions in both glycosylation-permissive and non-permissive conditions

  • Include well-characterized interaction pairs as positive controls

  • Use non-interacting proteins as negative controls

  • Consider the impact of epitope tags on interaction detection

This comprehensive approach provides a robust framework for distinguishing between direct physical interactions, functional relationships, and indirect associations among OST complex subunits, yielding insights into the molecular architecture and functional organization of the oligosaccharyltransferase complex.

What are the current technical challenges in OST2 research?

Despite significant advances, several technical challenges continue to impact OST2 research:

  • Membrane Protein Structural Analysis:
    The transmembrane nature of OST2 presents substantial difficulties for high-resolution structural studies. While cryo-EM has advanced our understanding of the oligosaccharyltransferase complex, atomic-level details of OST2's position and interactions remain challenging to determine. Future applications of lipid nanodisc technologies and advanced crystallization techniques may overcome these limitations.

  • In Vitro Reconstitution:
    Reconstituting fully functional oligosaccharyltransferase complexes from purified components, including OST2, remains difficult. The complex membrane environment and multiple protein-protein interactions present significant reconstitution challenges. Developing improved membrane mimetics and controlled assembly protocols represents an important technical frontier.

  • Temporal Resolution of Glycosylation:
    Current methods provide limited temporal resolution for studying the dynamics of OST2 function during glycosylation. Development of real-time assays with fluorescent or FRET-based reporters could provide crucial insights into the kinetics of OST2's role during the glycosylation process.

  • Distinguishing Direct and Indirect Effects:
    Separating direct effects of OST2 mutations from secondary consequences of glycosylation defects presents analytical challenges. Enhanced approaches combining rapid inactivation techniques with immediate phenotypic assessment could help resolve this ambiguity.

What emerging research directions show promise for advancing OST2 understanding?

Several innovative approaches show particular promise for future OST2 research:

  • Integrative Structural Biology:
    Combining multiple structural techniques (cryo-EM, cross-linking mass spectrometry, molecular dynamics) to build comprehensive models of OST2 within the oligosaccharyltransferase complex. This approach can overcome limitations of individual methods and provide more complete structural insights.

  • Single-Molecule Studies:
    Applying single-molecule techniques to observe individual glycosylation events could reveal mechanistic details obscured in bulk measurements. Techniques such as single-molecule FRET or nanopore analysis may provide unprecedented insights into OST2 function.

  • Systems Biology Integration:
    Placing OST2 function within genome-wide interaction networks through large-scale genetic interaction mapping, transcriptomics, and proteomics approaches. This can reveal unexpected connections between N-glycosylation and other cellular processes.

  • Translational Applications:
    Exploring how insights from yeast OST2 can inform understanding of human DAD1 and its role in disease contexts, particularly in cancer and neurodegenerative disorders where glycosylation abnormalities are implicated.

  • Synthetic Biology Approaches:
    Engineering modified OST2 variants with altered specificity or enhanced activity could enable novel glycoengineering applications. This might include designing glycosylation machinery capable of incorporating non-natural sugars or modifying glycosylation site preferences.

By addressing these challenges and pursuing these promising directions, researchers can advance our understanding of OST2's fundamental role in protein glycosylation and potentially develop applications in biotechnology and medicine based on this knowledge.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.