Recombinant Saccharomyces cerevisiae Dolichyl-phosphate beta-glucosyltransferase (ALG5)

Shipped with Ice Packs
In Stock

Description

Enzymatic Role and Biological Significance

ALG5 (encoded by the ALG5 gene in S. cerevisiae) catalyzes the synthesis of Dol-P-Glc, a glucose donor for ER luminal glycosyltransferases (Alg6, Alg8, and Alg10) during N-glycan precursor assembly . Key features include:

  • Subcellular Localization: ER membrane-bound, with multiple transmembrane domains .

  • Functional Partners: Interacts with Alg3, Alg6, and Alg12, which are involved in sequential glycosylation steps .

  • Orthologs: Functionally conserved across eukaryotes, including humans (ALG5) and Schizosaccharomyces pombe (O60061) .

Protein Characteristics

PropertyDetails
Molecular Weight38.3 kDa (S. cerevisiae)
Catalytic ActivityTransfers glucose from UDP-Glc to Dol-P (Km for UDP-Glc: 0.2 mM)
TopologyMulti-pass transmembrane protein with luminal active sites
Sequence Homology25–30% identity with human ALG5; shares motifs with Dpm1

Key Mutational Studies

  • Knockout Phenotype: S. cerevisiae alg5Δ mutants exhibit hypoglycosylation of vacuolar carboxypeptidase Y (CPY) and growth defects .

  • Complementation: Recombinant Drosophila ALG5 partially restores glycosylation in yeast mutants, while disease-associated human variants (e.g., p.Arg50Gln) impair activity .

Recombinant Expression Systems

Recombinant ALG5 has been expressed in Escherichia coli and yeast for functional studies:

Expression Platforms

Host SystemTagPurityApplicationSource
E. coliN-terminal His>90%Enzymatic assays, structural studies
S. cerevisiaeNativeN/AComplementation of alg5Δ strains

Functional Validation

  • Enzymatic Activity: Recombinant ALG5 from Trichomonas vaginalis shows 300-fold higher Dol-P-Glc synthase activity than S. cerevisiae .

  • Therapeutic Relevance: Engineered yeast strains expressing ALG5 are explored for producing humanized glycoproteins with reduced immunogenicity .

Glycoengineering

  • Humanized Glycosylation: Deletion of hypermannosylation genes (e.g., OCH1) and overexpression of ALG5 enable production of simplified N-glycans in Pichia pastoris .

  • Biopharmaceuticals: Recombinant ALG5 supports the synthesis of glucosylated lipid precursors, critical for monoclonal antibody production .

Disease Models

  • Kidney Disease: Heterozygous ALG5 variants disrupt N-glycan synthesis and polycystin-1 (PC1) maturation, linking glycosylation defects to autosomal-dominant polycystic kidney disease .

Future Directions

  • CRISPR-Cas9 Engineering: Precision editing of ALG5 in industrial yeast strains to optimize glycan profiles .

  • Structural Studies: Cryo-EM analysis of ALG5-Dol-P interactions to guide inhibitor design for glycosylation disorders .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have specific format requirements, please include them in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery estimates, please consult your local distributor.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is preferred, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have specific tag type preferences, please communicate them to us. We will prioritize development of the specified tag.
Synonyms
ALG5; YPL227C; P1437; Dolichyl-phosphate beta-glucosyltransferase; DolP-glucosyltransferase; Asparagine-linked glycosylation protein 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-334
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
Target Protein Sequence
MRALRFLIENRNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAIDEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLKEKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGKGGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDAISKIETSSTDLKTTKPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCGFKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDGSKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC
Uniprot No.

Target Background

Database Links

KEGG: sce:YPL227C

STRING: 4932.YPL227C

Protein Families
Glycosyltransferase 2 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass type II membrane protein. Note=Its interaction with the substrate UDP-glucose may occur at the cytoplasmic side of the ER, whereas the steps utilizing dolichyl beta-D-glucosyl phosphate take place in the lumen of the ER.

Q&A

What is ALG5 and what is its function in Saccharomyces cerevisiae?

ALG5 encodes UDP-glucose:dolichyl-phosphate glucosyltransferase, a transmembrane-bound enzyme localized in the endoplasmic reticulum. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate, playing a crucial role in protein N-linked glycosylation . It specifically participates in the glucosylation of the oligomannose core, which is necessary to ensure substrate recognition and efficient transfer of the oligomannose core to nascent glycoproteins .

What is the genetic structure and location of the ALG5 gene?

The ALG5 gene in Saccharomyces cerevisiae contains an open reading frame of 1002 bases that encodes a transmembrane protein with a molecular mass of 38.3 kDa . In humans, the homologous gene is located on chromosome 13 at position 13q13.3 and consists of 11 exons . The gene is also known by alternative names including PKD7 and bA421P11.2 in human genomic databases .

What happens when ALG5 is deleted in yeast cells?

Deletion of the ALG5 gene in Saccharomyces cerevisiae results in:

  • Complete loss of UDP-glucose:dolichyl-phosphate glucosyltransferase activity

  • Concomitant underglycosylation of secretory proteins like carboxypeptidase Y

  • Altered N-linked glycosylation patterns

  • Potentially impaired protein folding in the endoplasmic reticulum

These phenotypic effects demonstrate the enzyme's essential role in the N-glycosylation pathway, though the deletion is not lethal to yeast cells.

What structural features characterize the ALG5 protein?

The ALG5 protein is a multi-spanning transmembrane protein with several key structural features:

FeatureDescription
Molecular Weight38.3 kDa in S. cerevisiae
Membrane TopologyMultiple transmembrane segments spanning the ER membrane
Functional DomainsCatalytic domain facing the ER lumen
Protein FamilyMember of the glycosyltransferase 2 family
Sequence SimilarityShows homology to GDP-mannose:dolichyl-phosphate mannosyltransferase (Dpm1p) from S. cerevisiae

Topological studies indicate that this enzyme spans the membrane multiple times, with specific domains responsible for substrate binding and catalytic activity .

What are the recommended methods for isolating and characterizing the ALG5 gene from Saccharomyces cerevisiae?

For successful isolation and characterization of the ALG5 gene, researchers should follow this methodological approach:

  • Gene Isolation: Employ complementation of an alg5-1 mutation in S. cerevisiae, which was the original method used to isolate this gene .

  • DNA Sequencing: Use standard DNA sequencing techniques to confirm the 1002-base open reading frame.

  • Expression Analysis:

    • Construct expression vectors containing the ALG5 gene under control of inducible promoters

    • Transform these vectors into both yeast and E. coli expression systems

    • Verify expression using Western blotting with anti-ALG5 antibodies

  • Activity Assays: Measure UDP-glucose:dolichyl-phosphate glucosyltransferase activity using radioisotope-labeled UDP-glucose as a substrate and analyzing the formation of dolichyl phosphate glucose .

How can researchers effectively overexpress ALG5 in heterologous systems?

For optimal overexpression of ALG5 in heterologous systems, implement the following protocol:

  • Yeast Expression System:

    • Clone the ALG5 gene into a high-copy-number yeast expression vector (e.g., pYES2)

    • Use a strong inducible promoter such as GAL1

    • Transform into an appropriate S. cerevisiae strain

    • Induce expression with galactose

    • Verify increased UDP-glucose:dolichyl-phosphate glucosyltransferase activity

  • E. coli Expression System:

    • Clone the ALG5 gene into a bacterial expression vector with an appropriate tag

    • Express in E. coli membrane fraction

    • Optimize expression conditions (temperature, IPTG concentration)

    • Purify using affinity chromatography

    • Note: Since ALG5 is a transmembrane protein, expression in E. coli may require optimization for proper folding

  • Verification Methods:

    • Western blot analysis

    • Enzymatic activity assays

    • Glycosylation pattern analysis of reporter proteins

How do mutations in ALG5 affect the glycosylation pathway and what are the downstream consequences?

Mutations in ALG5 disrupt the N-linked glycosylation pathway with cascading effects:

  • Primary Biochemical Effects:

    • Reduced or absent formation of dolichyl phosphate glucose

    • Incomplete assembly of the lipid-linked oligosaccharide precursor

    • Altered glycan structure on nascent glycoproteins

  • Secondary Cellular Effects:

    • Activation of the unfolded protein response due to accumulation of misfolded glycoproteins

    • Altered protein trafficking and secretion

    • Changes in cell wall integrity in yeast models

  • Phenotypic Manifestations:

    • In yeast: Underglycosylation of secretory proteins such as carboxypeptidase Y

    • In humans: Associated with Polycystic Kidney Disease 7 (PKD7)

Experimental approach for studying these effects should include:

  • Site-directed mutagenesis of conserved residues

  • Analysis of glycan structures using mass spectrometry

  • Assessment of protein folding and trafficking using reporter proteins

What are the optimal experimental designs for studying ALG5 function in recombinant expression systems?

When designing experiments to study ALG5 function in recombinant systems, researchers should consider these methodological approaches:

  • Experimental Design Structure:

    • Implement controlled variable manipulation with appropriate randomization

    • Utilize true experimental designs with control and experimental groups

    • Include both positive controls (wild-type ALG5) and negative controls (deletion mutants)

  • Expression System Selection:

    • For basic functional studies: S. cerevisiae with ALG5 deletion background

    • For protein-protein interaction studies: Split-ubiquitin yeast two-hybrid system

    • For structural studies: Insect cell or mammalian expression systems

  • Functional Assays:

    • Enzymatic activity measurement using radiolabeled substrates

    • Glycoprotein analysis by SDS-PAGE and specific glycan staining

    • Subcellular localization using fluorescently tagged ALG5 constructs

  • Data Analysis Framework:

    • Quantitative assessment of enzyme kinetics

    • Statistical analysis of glycosylation patterns

    • Comparison of phenotypic effects across different mutations

How does ALG5 interact with other components of the N-linked glycosylation machinery?

ALG5 functions within a complex network of enzymes in the N-linked glycosylation pathway:

  • Known Protein-Protein Interactions:

    • Potential interactions with other ALG-family glycosyltransferases

    • Functional relationships with dolichol pathway enzymes

    • Possible regulatory interactions with ER quality control machinery

  • Experimental Approaches to Study Interactions:

    • Co-immunoprecipitation with tagged ALG5 constructs

    • Proximity labeling techniques (BioID or APEX)

    • Genetic interaction screens using synthetic lethality analysis

    • Fluorescence resonance energy transfer (FRET) for direct interaction studies

  • Integration in the Glycosylation Pathway:

    • ALG5 provides the dolichyl phosphate glucose substrate used by ALG6, ALG8, and ALG10

    • Sequential action in the pathway suggests potential substrate channeling mechanisms

    • Coordination with oligosaccharyltransferase complex for transfer to nascent proteins

What are common challenges in expressing active recombinant ALG5 and how can they be addressed?

Researchers frequently encounter several technical challenges when working with recombinant ALG5:

  • Protein Solubility and Membrane Integration:

    • Challenge: As a multi-spanning membrane protein, ALG5 often aggregates when overexpressed

    • Solution: Use specialized membrane protein expression systems such as C43(DE3) E. coli strain or Pichia pastoris; optimize detergent conditions for extraction

  • Enzymatic Activity Preservation:

    • Challenge: Loss of activity during purification procedures

    • Solution: Develop gentle purification protocols; consider using nanodisc technology to maintain a native-like lipid environment

  • Expression Level Optimization:

    • Challenge: Low expression yields

    • Solution: Test different promoter strengths, optimize codon usage for the expression host, and evaluate induction conditions systematically

  • Functional Verification:

    • Challenge: Confirming that the recombinant protein is correctly folded and active

    • Solution: Develop robust activity assays; use complementation of ALG5-deficient yeast strains as a functional test

How can researchers accurately measure and quantify ALG5 enzymatic activity?

For precise measurement of ALG5 enzymatic activity, implement this methodological workflow:

  • In Vitro Enzymatic Assay:

    • Prepare membrane fractions containing ALG5 (native or recombinant)

    • Incubate with UDP-[14C]glucose and dolichyl phosphate substrates

    • Extract lipid-linked products with organic solvents

    • Quantify radioactive dolichyl phosphate glucose by scintillation counting

  • In Vivo Activity Assessment:

    • Transform ALG5 constructs into alg5-deficient yeast

    • Analyze glycosylation status of reporter proteins (e.g., carboxypeptidase Y)

    • Assess glycoform distribution using SDS-PAGE mobility shifts or mass spectrometry

  • Kinetic Parameter Determination:

    • Measure initial reaction rates at varying substrate concentrations

    • Calculate Km and Vmax values for both UDP-glucose and dolichyl phosphate

    • Evaluate potential inhibitors using competitive binding assays

  • Data Analysis and Normalization:

    • Normalize activity to protein expression levels

    • Implement appropriate negative controls (heat-inactivated enzyme)

    • Use statistical methods to ensure reproducibility and significance

How can ALG5 be utilized in therapeutic applications for glycosylation disorders?

ALG5's critical role in N-glycosylation suggests several therapeutic applications:

  • Gene Therapy Approaches:

    • Delivery of functional ALG5 using viral vectors to correct glycosylation defects

    • CRISPR-Cas9 mediated repair of ALG5 mutations in patient-derived cells

  • Enzyme Replacement Strategies:

    • Development of recombinant ALG5 with enhanced membrane permeability

    • Targeted delivery systems for ER localization

  • Small Molecule Modulators:

    • High-throughput screening for compounds that enhance residual ALG5 activity

    • Chemical chaperones to improve folding of mutant ALG5 proteins

  • Recombinant Yeast-Based Approaches:

    • Engineered S. cerevisiae expressing human ALG5 could serve as cellular factories for correctly glycosylated therapeutic proteins

    • Whole recombinant yeast systems may have applications in immunotherapy, similar to approaches tested for cancer treatments

What are promising research directions for understanding ALG5 structure-function relationships?

Future research on ALG5 structure-function relationships should focus on:

  • Structural Biology Approaches:

    • Cryo-electron microscopy for membrane-embedded ALG5

    • X-ray crystallography of solubilized domains

    • In silico molecular modeling and molecular dynamics simulations

  • Functional Domain Mapping:

    • Systematic mutagenesis of conserved residues

    • Creation of chimeric proteins with related glycosyltransferases

    • Identification of substrate binding sites and catalytic residues

  • Evolutionary Analysis:

    • Comparative genomics across species to identify conserved features

    • Analysis of ALG5 homologs in different organisms to understand functional divergence

    • Investigation of the evolutionary relationship with related enzymes like Dpm1p

  • Regulatory Mechanisms:

    • Study of post-translational modifications affecting ALG5 activity

    • Investigation of protein-protein interactions that regulate ALG5 function

    • Analysis of transcriptional and translational control mechanisms

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.