Recombinant Saccharomyces cerevisiae Dynamin-like GTPase MGM1, mitochondrial (MGM1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us for preferential development.
Synonyms
MGM1; MDM17; YOR211C; YOR50-1; Dynamin-like GTPase MGM1, mitochondrial; Mitochondrial division and morphology protein 17; Mitochondrial genome maintenance protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
140-881
Protein Length
Full Length of Mature Protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
MGM1
Target Protein Sequence
ATLIAATSLDDDESKRQGDPKDDDDEDDDDEDDENDSVDTTQDEMLNLTKQMIEIRTILN KVDSSSAHLTLPSIVVIGSQSSGKSSVLESIVGREFLPKGSNMVTRRPIELTLVNTPNSN NVTADFPSMRLYNIKDFKEVKRMLMELNMAVPTSEAVSEEPIQLTIKSSRVPDLSLVDLP GYIQVEAADQPIELKTKIRDLCEKYLTAPNIILAISAADVDLANSSALKASKAADPKGLR TIGVITKLDLVDPEKARSILNNKKYPLSMGYVGVITKTPSSINRKHLGLFGEAPSSSLSG IFSKGQHGQSSGEENTNGLKQIVSHQFEKAYFKENKKYFTNCQVSTKKLREKLIKILEIS MSNALEPTSTLIQQELDDTSYLFKVEFNDRHLTPKSYLLNNIDVLKLGIKEFQEKFHRNE LKSILRAELDQKVLDVLATRYWKDDNLQDLSSSKLESDTDMLYWHKKLELASSGLTKMGI GRLSTMLTTNAILKELDNILESTQLKNHELIKDLVSNTAINVLNSKYYSTADQVENCIKP FKYEIDLEERDWSLARQHSINLIKEELRQCNSRYQAIKNAVGSKKLANVMGYLENESNLQ KETLGMSKLLLERGSEAIFLDKRCKVLSFRLKMLKNKCHSTIEKDRCPEVFLSAVSDKLT STAVLFLNVELLSDFFYNFPIELDRRLTLLGDEQVEMFAKEDPKISRHIELQKRKELLEL ALEKIDSILVFKKSYKGVSKNL
Uniprot No.

Target Background

Function

Dynamin-related GTPase essential for mitochondrial fusion. It coordinates interactions between the inner and outer mitochondrial membranes, facilitating the formation of the double membrane.

Gene References Into Functions

References:

  1. Mgm1 membrane interactions exert a mechanical force, overcoming phospholipid head group repulsion to initiate fusion. PMID: 25784211
  2. Psd1 promotes mitochondrial fusion by modulating mitochondrial membrane biophysical properties and alternative Mgm1 topogenesis. PMID: 23045528
  3. Mechanistic details of Mgm1's in vivo functions (membrane fusion and cristae maintenance) are described. PMID: 22977249
  4. Loss of mitochondrial fusion in Δmgm1 mutants significantly reduces replicative and chronological lifespan. PMID: 21912203
  5. Charged residues flanking Mgm1p's first segment critically affect isoform ratios, offering insights into mitochondrial inner membrane protein insertion. PMID: 21457713
  6. Trans-Mgm1 interactions on opposing inner membranes tether and fuse these membranes, maintaining crista structures. A model for mitochondrial dynamin function in fusion is proposed. PMID: 17055438
  7. Mgm1 facilitates fusion of opposing mitochondrial inner membranes. PMID: 19703904
  8. Mgm1 isoform coassembly, dependent on cardiolipin, mediates mitochondrial inner membrane fusion. PMID: 19752025
Database Links

KEGG: sce:YOR211C

STRING: 4932.YOR211C

Protein Families
TRAFAC class dynamin-like GTPase superfamily, Dynamin/Fzo/YdjA family
Subcellular Location
[Dynamin-like GTPase MGM1 large isoform]: Mitochondrion inner membrane; Single-pass type II membrane protein; Intermembrane side. Mitochondrion intermembrane space.; [Dynamin-like GTPase MGM1 small isoform]: Mitochondrion inner membrane; Peripheral membrane protein; Intermembrane side.

Q&A

What is MGM1 and what is its primary function in yeast cells?

MGM1 is a nuclear gene in Saccharomyces cerevisiae that encodes a dynamin-related GTPase protein essential for maintaining mitochondrial DNA (mtDNA) and proper mitochondrial morphology. The gene encodes a positively charged protein of 269 amino acids with a calculated molecular weight of 30 kDa . MGM1 is located adjacent to the ribosomal protein gene RPS7A on chromosome X and exists as a single copy in the genome .

The primary function of MGM1 is facilitating mitochondrial fusion. While it is not essential for general cellular viability, MGM1 is critical for maintaining the mitochondrial genome. Null mutants created by targeted disruption demonstrate that the gene has no essential cellular function besides its participation in mitochondrial genome maintenance . Expression studies show that MGM1 transcription is regulated by carbon source availability, with low expression on glucose medium and a two-fold increase when cells are grown on galactose .

How does MGM1 protein structure relate to its function?

MGM1 contains several functional domains characteristic of dynamin-related GTPases that are crucial for its activity:

DomainAmino Acid PositionFunction
GTPase domain~200-250GTP binding and hydrolysis; essential for fusion activity
Middle domain~250-500Self-assembly and structural stability
GED (GTPase Effector Domain)~700-850Self-assembly and regulation of GTPase activity
Transmembrane segmentN-terminal regionPresent only in l-Mgm1; anchors protein to inner membrane

The GTPase domain is particularly critical, as mutations in conserved residues (K223A, S224N, T244A) completely abolish the protein's ability to facilitate mitochondrial fusion . These residues are conserved among dynamin and dynamin-related GTPases, and equivalent mutations in dynamin inhibit its GTP binding and/or hydrolysis . The GED domain is also essential, with mutations at R824A and K854A significantly impairing mitochondrial morphology and fusion capacity .

What methodological approaches are most effective for studying MGM1 expression?

For effective study of MGM1 expression, researchers should consider these methodological approaches:

When studying MGM1 expression, consider that carbon source affects expression levels, with higher expression in respiratory conditions compared to fermentative conditions . This is consistent with the protein's role in maintaining mitochondrial function, which becomes more critical during respiratory growth.

What are the different isoforms of MGM1 and how are they generated?

MGM1 exists in two distinct isoforms with different subcellular localizations and functions:

  • Large isoform (l-Mgm1): This form contains an N-terminal putative transmembrane segment that anchors it as an integral protein in the inner mitochondrial membrane, with the bulk of the protein facing the intermembrane space .

  • Short isoform (s-Mgm1): This form lacks the N-terminal transmembrane segment and is localized primarily in the intermembrane space .

The generation of these isoforms occurs through proteolytic processing rather than alternative splicing. Specifically, the conversion of l-Mgm1 into s-Mgm1 is dependent on a protease called Pcp1 (also known as Mdm37/YGR101w) . Pcp1 is a homolog of Rhomboid, a serine protease known to be involved in intercellular signaling in Drosophila melanogaster . This suggests that Pcp1 functions in the proteolytic maturation process of Mgm1, cleaving the transmembrane domain to generate the short isoform.

Importantly, both isoforms appear to be essential for proper mitochondrial function. Expression of either isoform alone cannot complement the Δmgm1 phenotype, while expression of both isoforms together can partially rescue the defects . This indicates that the proper ratio and interaction between these isoforms are crucial for MGM1's role in mitochondrial dynamics.

How can researchers effectively investigate the processing of MGM1 isoforms?

To effectively study MGM1 isoform processing, researchers should consider the following methodological approaches:

  • Subcellular fractionation and immunoblotting: This allows detection of both isoforms in different mitochondrial compartments. Optimize protocols to separate inner membrane, outer membrane, and intermembrane space fractions to determine precise localization of each isoform.

  • In vitro processing assays: Using purified mitochondria and recombinant Pcp1 protease to observe the conversion of l-Mgm1 to s-Mgm1 under controlled conditions. Include protease inhibitors as controls to confirm specificity.

  • Pulse-chase experiments: These can track the kinetics of conversion from the large to the short isoform in vivo. Design experiments with appropriate time intervals (5-30 minutes) to capture the processing event.

  • Site-directed mutagenesis: Creating mutations in the predicted cleavage site can help identify the exact residues required for Pcp1 recognition and processing. Focus on residues near the transmembrane domain-soluble domain junction.

  • Pcp1 conditional mutants: Temperature-sensitive or chemically-inducible Pcp1 mutants can be used to modulate the processing activity and observe effects on MGM1 isoform distribution and mitochondrial morphology.

When designing these experiments, control for carbon source effects as these can influence expression levels and potentially processing efficiency . Additionally, include mitochondrial morphology assessment as a functional readout of proper MGM1 processing and activity.

How does MGM1 contribute to mitochondrial fusion at the molecular level?

MGM1 plays a critical role in mitochondrial fusion through multiple molecular mechanisms:

  • Regulation of both outer and inner membrane fusion: Unlike some mitochondrial proteins that specifically impact either outer or inner membrane dynamics, MGM1 is essential for fusion of both membranes . In zygotes formed by mating mgm1 mutants, mitochondria fail to fuse and mix their contents , indicating its foundational role in the fusion process.

  • GTPase-dependent mechanism: MGM1's GTPase activity is absolutely required for fusion. Mutations in conserved residues of the GTPase domain (K223A, S224N, T244A) completely block mitochondrial fusion . This suggests that GTP binding and/or hydrolysis provides the energy necessary to drive membrane remodeling during fusion.

  • Protein complex formation: MGM1 physically interacts with other fusion machinery components, specifically Fzo1p and Ugo1p in the mitochondrial outer membrane . This creates a multi-protein complex that likely coordinates the fusion of both mitochondrial membranes. These interactions may help connect the inner membrane (where l-Mgm1 is anchored) to the outer membrane fusion apparatus.

  • Self-assembly properties: Evidence from genetic complementation studies suggests that MGM1 self-assembles into higher-order structures . In diploids from crosses of certain mgm1 temperature-sensitive (ts) mutants, intragenic complementation was observed, with different mutations in MGM1 compensating for one another within an assembled MGM1 complex . This self-assembly property is likely crucial for generating the mechanical force needed to bring membranes together during fusion.

  • Inner membrane remodeling: MGM1 appears to function in remodeling the inner membrane and cristae formation , which may be a prerequisite step for efficient fusion.

The dual isoform system (l-Mgm1 and s-Mgm1) appears to be crucial for fusion, as expression of both isoforms, but not either isoform alone, can partially complement the Δmgm1 phenotype .

What experimental approaches can be used to assess MGM1's fusion activity?

Several robust experimental approaches can assess MGM1's fusion activity:

  • In vivo mitochondrial fusion assay: This classic approach involves mating yeast cells with differently labeled mitochondria (e.g., matrix-targeted GFP and RFP) and observing content mixing. When analyzing mgm1 mutants, include appropriate controls such as wild-type cells and known fusion-defective strains (e.g., fzo1 mutants) .

  • Double mutant analysis with fission machinery: Creating mgm1 dnm1 double mutants allows assessment of MGM1's fusion function independent of morphological defects. While dnm1 deletion suppresses the fragmentation phenotype in mgm1 mutants by blocking fission, it does not restore fusion capacity .

  • Electron microscopy: This method provides high-resolution assessment of both outer and inner membrane fusion defects. Particular attention should be paid to cristae architecture, as mgm1 mutants display aberrant inner membrane cristae that can be restored in mgm1 dnm1 double mutants .

  • Protease protection assays: These can assess the integrity of both mitochondrial membranes during fusion attempts. Design experiments with incremental protease concentrations to detect subtle defects in membrane integrity.

  • GTPase activity measurements: In vitro GTPase assays using purified MGM1 protein or mitochondrial extracts can directly measure the enzymatic activity critical for fusion. Compare wild-type protein with GTPase domain mutants as controls.

  • Fluorescence recovery after photobleaching (FRAP): This technique can assess the dynamics of mitochondrial content exchange in living cells, providing kinetic information about the fusion process.

When designing these experiments, researchers should consider the carbon source used for growth media, as MGM1 expression is regulated by carbon source availability . Additionally, temperature control is critical when working with temperature-sensitive alleles.

How do mutations in different MGM1 domains differentially affect mitochondrial morphology and function?

Mutations in different MGM1 domains produce distinct effects on mitochondrial morphology and function:

DomainMutationEffect on MorphologyEffect on mtDNAEffect on FusionReference
GTPaseK223ASevere fragmentationLossComplete block
GTPaseS224NSevere fragmentationLossComplete block
GTPaseT244ASevere fragmentationLossComplete block
GEDR824APartial fragmentationPartial lossPartial defect
GEDK854APartial fragmentationPartial lossPartial defect

GTPase domain mutations (K223A, S224N, T244A) produce the most severe phenotypes, completely blocking mitochondrial fusion and leading to extensive fragmentation and loss of mtDNA . This indicates that GTP binding and hydrolysis are absolutely essential for MGM1 function.

Mutations in the GED domain (R824A, K854A) produce intermediate phenotypes, with partial defects in mitochondrial morphology and fusion capacity . This suggests that while the GED domain is important for optimal function, possibly through regulating GTPase activity or facilitating self-assembly, some residual activity remains when it is compromised.

Interestingly, the context of the mutation matters significantly. The requirement for MGM1 function appears to be diminished in the context of mitochondrial tubules compared to fragments . This explains why some mutations show more severe phenotypes when assessed for morphology in single mutants versus fusion capacity in double mutants with dnm1 .

The processing of MGM1 is also critical, as preventing the generation of both isoforms impairs function. Neither isoform alone can complement the Δmgm1 phenotype, while expression of both isoforms together can partially rescue the defects .

What are the major challenges in producing recombinant MGM1 for structural studies?

Producing recombinant MGM1 for structural studies presents several significant challenges:

  • Membrane protein expression barriers: The large isoform (l-Mgm1) contains a transmembrane domain that complicates expression in conventional bacterial systems. This hydrophobic region often leads to protein aggregation, misfolding, or toxicity to the host cells. Researchers should consider specialized expression systems designed for membrane proteins, such as cell-free systems supplemented with lipids or detergents.

  • Dual isoform complexity: Both l-Mgm1 and s-Mgm1 isoforms appear necessary for full function , suggesting that structural studies might need to capture both forms and their interactions. This requires either co-expression strategies or separate purification followed by reconstitution experiments.

  • GTPase activity preservation: The GTPase domain is critical for function , and maintaining its proper folding and activity during purification is challenging. Protein preparation should include GTP or non-hydrolyzable GTP analogs to stabilize the active conformation.

  • Self-assembly properties: MGM1 appears to self-assemble into higher-order structures , which can complicate uniform sample preparation for crystallography or cryo-EM. Size exclusion chromatography and analytical ultracentrifugation should be employed to characterize the oligomeric state.

  • Post-translational modifications: Any yeast-specific modifications may be absent in bacterial expression systems. Consider eukaryotic expression systems such as insect cells or yeast itself for more native-like protein production.

For recombinant expression, the following strategy can be effective:

a) Express the short isoform (s-Mgm1) lacking the transmembrane domain for initial structural studies
b) Use a eukaryotic expression system (P. pastoris or insect cells)
c) Include purification tags that can be precisely removed without affecting protein structure
d) Maintain GTP or GTP analogs throughout purification
e) Verify functional activity through in vitro GTPase assays

How can researchers effectively study MGM1 protein-protein interactions and complex formation?

To effectively study MGM1 protein-protein interactions and complex formation, researchers should employ these methodological approaches:

  • Co-immunoprecipitation (Co-IP): This technique can identify native interactions between MGM1 and its binding partners (such as Fzo1p and Ugo1p) . For optimal results, use mild detergents like digitonin or DDM for membrane protein extraction, and include GTP in buffers to stabilize interactions dependent on the GTPase domain.

  • Yeast two-hybrid (Y2H) analysis with membrane protein adaptations: Traditional Y2H may not work well for membrane proteins, but split-ubiquitin Y2H systems designed for membrane proteins can overcome this limitation. This approach can detect direct binary interactions between MGM1 and other mitochondrial proteins.

  • Bimolecular Fluorescence Complementation (BiFC): This in vivo technique can visualize protein interactions in their native cellular context. By fusing complementary fragments of a fluorescent protein to MGM1 and potential interaction partners, researchers can directly visualize interactions through fluorescence microscopy.

  • Cross-linking mass spectrometry (XL-MS): This approach can capture transient interactions and provide structural information about protein complexes. Use membrane-permeable crosslinkers for in vivo studies or purified components for in vitro analysis.

  • Blue Native PAGE: This technique separates native protein complexes and can identify higher-order MGM1-containing assemblies in mitochondrial extracts. Include a range of detergent concentrations to optimize complex preservation.

  • Genetic interaction screens: Systematic genetic interaction mapping (e.g., synthetic genetic array analysis) can identify functional relationships between MGM1 and other genes. Look for genetic interactions that show epistasis or synergy with MGM1 mutations.

  • Intragenic complementation analysis: As demonstrated with temperature-sensitive mgm1 mutants , this approach can provide insights into protein self-assembly. Test different combinations of mutations affecting distinct domains to assess complementation.

When designing these experiments, consider that MGM1 interactions may be influenced by:

  • The specific isoform (l-Mgm1 vs. s-Mgm1)

  • GTP binding status

  • Mitochondrial membrane potential

  • Carbon source used for growth

What are the current contradictions or unresolved questions in MGM1 research?

Several important contradictions and unresolved questions remain in MGM1 research that merit further investigation:

Researchers investigating these questions should combine structural approaches (cryo-EM, X-ray crystallography), in vitro reconstitution systems, and sophisticated in vivo imaging techniques to resolve these contradictions and advance our understanding of this essential mitochondrial protein.

How can CRISPR-Cas9 genome editing be optimized for studying MGM1 function?

CRISPR-Cas9 genome editing offers powerful approaches for studying MGM1 function with unprecedented precision:

  • Domain-specific mutagenesis: Rather than complete gene knockout, researchers can introduce specific mutations in functional domains:

    • Target the GTPase domain (residues K223, S224, T244) to study GTP binding/hydrolysis

    • Modify the GED domain (residues R824, K854) to investigate self-assembly mechanisms

    • Alter the Pcp1 cleavage site to prevent processing from l-Mgm1 to s-Mgm1

    When designing guide RNAs, ensure they target conserved residues identified in previous mutational studies while avoiding off-target effects by using highly specific guides with minimal homology elsewhere in the genome.

  • Endogenous tagging strategies: CRISPR can introduce fluorescent or affinity tags at the endogenous locus without disrupting gene function:

    • C-terminal tagging (preserves N-terminal targeting sequence)

    • Internal tagging (between domains to minimize functional disruption)

    • Split fluorescent protein tags to study self-assembly

    For optimal results, include flexible linkers (GGGGS)n between the protein and tag, and validate that the tagged protein maintains wildtype function through complementation assays.

  • Inducible expression systems: Create strains with inducible MGM1 expression to study acute effects:

    • TetR-regulated promoter replacement

    • Auxin-inducible degron system for rapid protein depletion

    • Galactose-inducible systems (leveraging the natural upregulation on galactose )

  • Isoform-specific manipulation: Design strategies to selectively express or deplete specific MGM1 isoforms:

    • Mutate the Pcp1 cleavage site to prevent s-Mgm1 generation

    • Express s-Mgm1 directly (bypassing processing) in mgm1 null background

    • Create switchable isoform systems to study temporal requirements

  • Base editing approach: For subtle mutations without double-strand breaks, cytosine or adenine base editors can introduce specific amino acid changes with minimal disruption to the locus.

When implementing these CRISPR strategies, include appropriate controls:

  • Unedited wildtype strains

  • Complete knockout strains

  • Complementation with wildtype MGM1 to verify phenotype reversibility

  • Sanger sequencing to confirm precise editing

What novel high-throughput approaches can accelerate MGM1 functional characterization?

Several cutting-edge high-throughput approaches can significantly accelerate MGM1 functional characterization:

  • Saturation mutagenesis coupled with phenotypic screening:

    • Generate comprehensive MGM1 variant libraries using error-prone PCR or array-synthesized oligonucleotides

    • Introduce these variants into mgm1Δ strains

    • Screen for mitochondrial morphology using automated microscopy

    • Select for mtDNA maintenance using growth on non-fermentable carbon sources

    • Deep sequencing of selected pools can identify functional residues

    This approach can map functional domains with single-amino acid resolution, revealing residues beyond those already identified in the GTPase and GED domains .

  • Protein-protein interaction mapping:

    • BioID or TurboID proximity labeling to identify the complete MGM1 interactome

    • Split protein complementation arrays to test interactions with all mitochondrial proteins

    • Systematic Co-IP coupled with mass spectrometry under different growth conditions

    These methods can reveal previously unknown interaction partners beyond the established Fzo1p and Ugo1p , potentially identifying regulatory proteins.

  • Cryo-electron tomography of mitochondria:

    • High-resolution imaging of mitochondrial fusion events in wild-type and mutant cells

    • Direct visualization of MGM1 assemblies at fusion sites

    • Correlative light and electron microscopy to capture dynamic events

    This approach can bridge structural studies of isolated proteins with cellular phenotypes to understand MGM1 function in its native context.

  • Metabolomics and multi-omics integration:

    • Compare metabolite profiles between wild-type and mgm1 mutant strains

    • Integrate with transcriptomics and proteomics data

    • Identify metabolic signatures associated with MGM1 dysfunction

    This systems-level approach can reveal downstream consequences of MGM1 dysfunction beyond the immediate effects on mitochondrial morphology.

  • Microfluidics-based single-cell analysis:

    • Measure cell-to-cell variability in mitochondrial morphology and membrane potential

    • Track real-time responses to perturbations in MGM1 function

    • Correlate mitochondrial phenotypes with cellular fitness metrics

When implementing these high-throughput approaches, researchers should:

  • Include appropriate controls for each technology

  • Validate key findings with traditional low-throughput approaches

  • Consider the effects of carbon source on MGM1 expression

  • Analyze both isoforms of MGM1 whenever possible

How might understanding MGM1 function contribute to addressing mitochondrial diseases in humans?

Understanding MGM1 function in yeast has significant translational potential for human mitochondrial diseases:

  • Direct relevance to OPA1-related disorders: The human ortholog of MGM1, known as OPA1, is associated with optic atrophy type I , a mitochondrial disease characterized by degeneration of retinal ganglion cells and the optic nerve. Insights from yeast MGM1 studies can directly inform:

    • Mechanism-based therapeutic approaches

    • Functional classification of patient mutations

    • Identification of potential genetic modifiers

    Specific findings from yeast, such as the importance of both MGM1 isoforms and the critical nature of the GTPase domain , provide focal points for human studies.

  • Mitochondrial dynamics in neurodegeneration: Beyond optic atrophy, mitochondrial fusion defects are implicated in broader neurodegenerative conditions:

    • Parkinson's disease

    • Alzheimer's disease

    • Charcot-Marie-Tooth disease

    The MGM1/OPA1 pathway represents a potential therapeutic target for these conditions. Yeast studies demonstrating that MGM1 interacts with proteins like Fzo1p and Ugo1p suggest the importance of examining similar interactions with human orthologs MFN1/2 and SLC25A46.

  • Potential therapeutic strategies based on yeast findings:

    • Small molecule modulators of GTPase activity

    • Peptide inhibitors of specific protein-protein interactions

    • Gene therapy approaches to restore proper isoform balance

    • Mitochondrial-targeted antioxidants to mitigate downstream effects

  • Biomarker development: Metabolic signatures identified in yeast mgm1 mutants could translate to human biomarkers for:

    • Early disease detection

    • Treatment response monitoring

    • Patient stratification for clinical trials

  • Drug screening platforms: Humanized yeast systems expressing OPA1 instead of MGM1 can provide:

    • High-throughput screens for compounds that rescue mitochondrial defects

    • Validation systems for candidate therapeutics before mammalian testing

    • Models for studying drug mechanisms of action

When pursuing these translational directions, researchers should consider:

  • Differences in mitochondrial biology between yeast and humans

  • The more complex tissue-specific effects in multicellular organisms

  • Additional regulatory mechanisms present in humans but absent in yeast

  • The influence of genetic background on phenotypic expression

The foundational mechanistic understanding from yeast studies—particularly the importance of GTPase activity , dual isoform function , and interactions with other fusion machinery components —provides crucial guidance for therapeutic development in human mitochondrial disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.