Recombinant Saccharomyces cerevisiae Elongation of fatty acids protein 1 (ELO1)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of Recombinant ELO1

Recombinant ELO1 is synthesized as a full-length protein (1–310 amino acids) fused to an N-terminal hexahistidine (His) tag for purification. Key specifications include:

PropertyDetail
Source OrganismSaccharomyces cerevisiae (Baker’s yeast)
Expression SystemE. coli
Molecular Weight~35 kDa (calculated from 310-amino-acid sequence)
Purity>90% (verified by SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
ReconstitutionRequires sterile water; glycerol (5–50%) recommended for stability

The amino acid sequence of ELO1 begins with MVSDWKNFCLEKASRFRPTIDRPFFNIYLWDYFNRAVGWATAG... and includes conserved domains critical for elongase activity .

Functional Role in Fatty Acid Elongation

ELO1 is a medium-chain fatty acid elongase that catalyzes the carboxy-terminal elongation of C12–C16 unsaturated fatty acyl-CoAs to C16–C18 species . It operates within a conserved endoplasmic reticulum (ER)-localized elongase complex alongside:

  • Ifa38: A reductase critical for very-long-chain fatty acid (VLCFA) synthesis .

  • Phs1: A dehydratase required for sphingolipid biosynthesis .

  • Tsc13: An enoyl reductase essential for lipid membrane integrity .

This complex ensures the production of VLCFAs, which regulate cell membrane rigidity, ER stress responses, and pathogenicity in fungi . In S. cerevisiae, ELO1 functionally overlaps with homologs ELO2 and ELO3, which extend fatty acids to C24–C26 for sphingolipid synthesis .

Key Findings from Studies:

  1. Substrate Specificity: ELO1 preferentially elongates unsaturated C12–C16 fatty acids, distinguishing it from ELO2/ELO3, which act on longer chains (C18–C26) .

  2. Complex Assembly: ELO1 interacts with Ole1 (∆9-desaturase) to coordinate unsaturated fatty acid distribution for phospholipid and triacylglycerol synthesis .

  3. Phenotypic Defects: Deletion of ELO1 in yeast results in:

    • Reduced VLCFA levels .

    • Aberrant spore morphogenesis and compromised membrane integrity .

    • Synthetic lethality when combined with ELO2/ELO3 mutations .

Research Applications

Recombinant ELO1 is primarily used for:

  • Enzymatic Assays: Investigating fatty acid elongation mechanisms in vitro .

  • Protein Interaction Studies: Mapping ER-associated elongase complexes via co-immunoprecipitation or luciferase complementation assays .

  • Structural Biology: Analyzing conserved motifs (e.g., histidine-rich regions) for drug targeting .

Industrial and Biomedical Relevance

While ELO1 itself is not directly utilized in biotechnology, its homologs in pathogenic fungi (e.g., Magnaporthe oryzae) are explored as antifungal targets. Inhibiting VLCFA synthesis disrupts fungal cell membranes, reducing virulence . In S. cerevisiae, ELO1’s interplay with lipid droplet formation informs biofuel research aimed at enhancing lipid yields .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
ELO1; YJL196C; J0343; Elongation of fatty acids protein 1; 3-keto acyl-CoA synthase ELO1; Very-long-chain 3-oxoacyl-CoA synthase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
ELO1
Target Protein Sequence
MVSDWKNFCLEKASRFRPTIDRPFFNIYLWDYFNRAVGWATAGRFQPKDFEFTVGKQPLS EPRPVLLFIAMYYVVIFGGRSLVKSCKPLKLRFISQVHNLMLTSVSFLWLILMVEQMLPI VYRHGLYFAVCNVESWTQPMETLYYLNYMTKFVEFADTVLMVLKHRKLTFLHTYHHGATA LLCYNQLVGYTAVTWVPVTLNLAVHVLMYWYYFLSASGIRVWWKAWVTRLQIVQFMLDLI VVYYVLYQKIVAAYFKNACTPQCEDCLGSMTAIAAGAAILTSYLFLFISFYIEVYKRGSA SGKKKINKNN
Uniprot No.

Target Background

Function
ELO1 is a component of a microsomal membrane-bound medium-chain fatty acid elongation system. This system extends medium-chain-length fatty acids to long-chain fatty acids. ELO1 is a component of elongase I, which extends 12-16-carbon fatty acyl-CoAs (such as lauroyl-CoA) to 14-18-carbon fatty acids by incorporating malonyl-CoA.
Database Links

KEGG: sce:YJL196C

STRING: 4932.YJL196C

Protein Families
ELO family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is ELO1 and what is its function in Saccharomyces cerevisiae?

ELO1 (Elongation of fatty acids protein 1) is a condensing enzyme (EC= 2.3.1.n8) encoded by the YJL196C gene in Saccharomyces cerevisiae . It functions as a component of the fatty acid elongation system, catalyzing the addition of two-carbon units to existing fatty acid chains. In S. cerevisiae, ELO1 shows substrate preference for medium-chain fatty acids and is involved in the elongation of C14 fatty acids to C16 fatty acids. The protein functions within a multienzyme complex at the endoplasmic reticulum membrane, where it participates in the first and rate-limiting step of the fatty acid elongation cycle .

How does ELO1 interact with other components in fatty acid biosynthesis?

ELO1 participates in a four-step cycle of fatty acid elongation, interacting with three other enzymes: a 3-ketoacyl-CoA reductase, a 3-hydroxyacyl-CoA dehydratase, and a trans-2,3-enoyl-CoA reductase. The elongation process begins with the condensation of malonyl-CoA with a long-chain acyl-CoA substrate, catalyzed by ELO1, followed by reduction, dehydration, and a second reduction step . Interaction data from the Saccharomyces Genome Database reveals that ELO1 has 128 total interactions with 110 unique genes, suggesting its involvement in complex regulatory networks beyond direct fatty acid synthesis .

What are the most effective methods for expressing recombinant ELO1 in heterologous systems?

For expressing recombinant ELO1 in heterologous systems, researchers commonly employ constitutive promoters such as the translation elongation factor 1-alpha (TEF2) promoter, which provides robust and consistent expression levels . The following approach has proven effective:

  • Create a high-copy yeast expression vector (such as pGI-100) containing the ELO1 gene under control of the TEF2 promoter

  • Design primers that include appropriate restriction sites for cloning (e.g., EcoRI and NotI)

  • Include a C-terminal tag (such as 6xHis) for purification and detection

  • Transform the construct into a suitable S. cerevisiae strain (e.g., S288C)

  • Confirm expression by Western blotting using anti-tag antibodies

For optimal expression, growth conditions should be maintained at 30°C in appropriate selective media to ensure plasmid retention .

How can researchers assess ELO1 activity in functional assays?

To assess ELO1 activity in experimental systems, researchers typically employ the following methodologies:

  • Fatty acid profiling: Gas chromatography-mass spectrometry (GC-MS) analysis of extracted cellular lipids to quantify changes in fatty acid chain length distribution

  • In vitro elongation assays: Using isolated microsomes containing recombinant ELO1 with radiolabeled substrates to measure incorporation rates

  • Complementation studies: Expressing ELO1 in yeast strains deficient in endogenous elongase activity to assess functional rescue

  • Substrate specificity determination: Providing various fatty acyl-CoA substrates and analyzing product formation

When interpreting results, it's essential to consider that ELO1 works as part of a multienzyme complex and requires endogenous components of the yeast elongation system to function properly .

How can ELO1 be used to engineer polyunsaturated fatty acid (PUFA) biosynthesis pathways?

ELO1 can be strategically employed in PUFA biosynthesis pathway engineering through the following approach:

  • Co-expression with desaturases: ELO1 can be co-expressed with specific fatty acid desaturases to create complete biosynthetic pathways for PUFAs. This combination allows for the synthesis of long-chain PUFAs from simpler precursors .

  • Substrate redirection: When heterologously expressed, the condensing enzyme activity of ELO1 interacts with endogenous components of the yeast elongation system, redirecting enzymatic activity toward specific fatty acid substrates .

  • Pathway optimization: The table below shows an example of PUFA production through combined desaturase and elongase activities:

Pathway ComponentSubstrateProductYield (%)
Δ6-desaturaseLinoleic acid (18:2n-6)γ-Linolenic acid (18:3n-6)5-15
ELO1 elongaseγ-Linolenic acid (18:3n-6)Dihomo-γ-linolenic acid (20:3n-6)30-40
Δ5-desaturaseDihomo-γ-linolenic acid (20:3n-6)Arachidonic acid (20:4n-6)20-25

Research has demonstrated that combining desaturase and elongation activities in recombinant yeast systems can generate significant amounts of valuable PUFAs like arachidonic acid from linoleic acid and eicosapentaenoic acid from α-linolenic acid .

What genetic modifications are necessary to optimize ELO1 expression and activity?

Optimizing ELO1 expression and activity requires several strategic genetic modifications:

  • Promoter selection: Replacing the native promoter with strong constitutive promoters like TEF2 or inducible promoters for controlled expression

  • Codon optimization: Adjusting the codon usage to match the preferred codons of the expression host

  • Signal sequence modification: Ensuring proper localization to the endoplasmic reticulum

  • Tag addition: Introducing epitope or affinity tags for purification and detection without disrupting function

  • Enzyme engineering: Making targeted mutations to enhance substrate specificity or catalytic efficiency

When optimizing expression, researchers should consider that overexpression of membrane proteins can cause cellular stress, potentially requiring additional modifications to the host strain to accommodate increased protein production .

What are the most reliable methods for analyzing fatty acid profiles in ELO1-expressing cells?

For comprehensive analysis of fatty acid profiles in ELO1-expressing cells, researchers should employ the following validated methods:

  • Gas Chromatography-Mass Spectrometry (GC-MS): Extract total cellular lipids using the Bligh and Dyer method, followed by transmethylation to create fatty acid methyl esters (FAMEs). Analyze FAMEs by GC-MS with appropriate standards for quantification.

  • Liquid Chromatography-Mass Spectrometry (LC-MS/MS): For more detailed analysis of intact lipid species and their fatty acid composition.

  • Radiolabeling studies: Incorporate 14C-labeled acetate or specific fatty acids to track elongation activity through the metabolic pathway.

  • Real-time monitoring: Use fluorescently-labeled fatty acid analogs to visualize fatty acid incorporation and metabolism in living cells.

Data interpretation should account for the complete fatty acid profile rather than individual changes, as alterations in one fatty acid often affect the entire pathway due to substrate competition and regulatory feedback mechanisms .

How can researchers distinguish between the activities of different elongases in experimental systems?

Distinguishing between the activities of different elongases requires sophisticated experimental approaches:

  • Substrate specificity profiling: Supply cells with different fatty acid substrates to determine the chain-length and saturation preferences of each elongase.

  • Selective inhibition: Use specific inhibitors that target particular elongases based on their catalytic mechanisms.

  • Genetic knockout and complementation: Create single or multiple elongase knockout strains, followed by selective reintroduction of individual elongases to attribute specific activities.

  • Kinetic analysis: Perform detailed enzyme kinetics with purified or membrane-embedded elongases to determine substrate affinities (Km) and reaction rates (Vmax).

  • Expression profiling: Monitor the expression levels of different elongases under various growth conditions using RT-qPCR or proteomics.

When interpreting results, researchers must consider that elongases like ELO1 often display overlapping substrate preferences with distinct optimal substrates, making complete separation of activities challenging .

What are the major challenges in expressing functional ELO1 in heterologous systems?

Expressing functional ELO1 in heterologous systems presents several significant challenges:

  • Membrane protein expression: As a transmembrane protein, ELO1 can cause toxicity when overexpressed, potentially leading to ER stress and protein aggregation.

  • Complex formation requirements: ELO1 functions as part of a multienzyme complex and requires interaction with endogenous components of the elongation system, which may not be present or compatible in heterologous hosts .

  • Post-translational modifications: Proper folding, glycosylation, and other modifications may be host-specific and affect protein function.

  • Cofactor availability: Ensuring sufficient malonyl-CoA and NADPH for elongation reactions can limit activity in non-native hosts.

  • Lipid environment: The membrane composition of heterologous hosts may not provide the optimal environment for ELO1 function.

To address these challenges, researchers can implement strategies such as using lower-copy vectors, inducible promoters with careful titration of expression levels, co-expression of chaperones, and engineering the host's lipid metabolism to better support ELO1 function .

How does ELO1 activity differ between native and recombinant expression systems?

ELO1 activity shows several important differences between native and recombinant expression systems:

To minimize these differences, researchers should carefully evaluate the host system and consider using closely related species or engineering the host to better mimic the native cellular environment of ELO1 .

How can CRISPR-Cas9 technology be applied to study ELO1 function?

CRISPR-Cas9 technology offers powerful approaches to study ELO1 function through:

  • Precise gene editing: Creating point mutations in the ELO1 gene to study structure-function relationships of specific amino acid residues.

  • Domain swapping: Replacing portions of ELO1 with corresponding regions from other elongases to identify domains responsible for substrate specificity or catalytic activity.

  • Promoter engineering: Modifying the native promoter region to alter expression patterns or create inducible systems.

  • Tagged variant creation: Introducing epitope or fluorescent tags at precise locations to monitor protein localization and interactions without disrupting function.

  • Regulatory element identification: Using CRISPR interference (CRISPRi) or activation (CRISPRa) to identify regulatory elements controlling ELO1 expression.

When designing CRISPR experiments, researchers should carefully select guide RNAs with minimal off-target effects and implement appropriate screening methods to identify successfully edited clones .

What are the implications of ELO1 research for metabolic engineering applications?

ELO1 research has significant implications for various metabolic engineering applications:

  • Designer oil production: Engineering yeast strains with modified ELO1 and related enzymes can create custom fatty acid profiles for specialized oils with industrial or nutritional applications.

  • Biofuel optimization: Modifying fatty acid chain length through ELO1 engineering can improve biofuel properties such as cetane number, oxidative stability, and cold flow properties.

  • Membrane stress tolerance: Understanding ELO1's role in membrane lipid composition can help develop strains with enhanced tolerance to industrial stresses such as high temperature, solvent exposure, or feedstock inhibitors .

  • Pharmaceutical precursor production: Engineered elongase systems incorporating ELO1 can produce specific fatty acid precursors for pharmaceutical compounds.

  • Model system development: ELO1 research in yeast provides valuable insights that can be translated to more complex organisms for understanding metabolic disorders related to fatty acid elongation.

The potential for combining ELO1 modifications with other genetic alterations creates opportunities for developing highly specialized yeast strains optimized for specific industrial applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.