Recombinant Saccharomyces cerevisiae Endoplasmic reticulum transmembrane protein 1 (YET1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Shipping is standard with blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag is required, please inform us, and we will prioritize its development.
Synonyms
YET1; YKL065C; YKL331; Endoplasmic reticulum transmembrane protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-206
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YET1
Target Protein Sequence
MSLYFTTLFLLLTVEMVMLFIFVLPLPFRIRRGIFSTYNQLTAKQQIKTIIFITGCLVGL LFIDSWKRSQIRVSLYHNDNSGSIGSSAVTPIQALASRAYNQRNMYISGFILYFSICIPT VMSIVKRLVKYQGLINEQEKQKLNKPSSNSKKDSNEADSTKLQEELRKKQISLEGLQKQV KNLEKYFDEKNQPGNVAAAEASKKGN
Uniprot No.

Target Background

Function

This protein may play a role in the anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi apparatus.

Database Links

KEGG: sce:YKL065C

STRING: 4932.YKL065C

Protein Families
BCAP29/BCAP31 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the role of YET1 in the endoplasmic reticulum of S. cerevisiae?

YET1 functions primarily as a membrane protein in the endoplasmic reticulum (ER) of Saccharomyces cerevisiae involved in protein folding processes. Similar to other ER membrane proteins such as Rot1, YET1 may function as a molecular chaperone that prevents aggregation of denatured proteins. In recombinant systems, YET1 can be studied for its potential role in facilitating proper folding of various proteins in the secretory pathway, including soluble and membrane proteins with different topologies . The protein likely interacts transiently with its substrate proteins, forming part of the quality control machinery that ensures proper protein folding in the ER.

How is YET1 related to other ER membrane proteins in the GET pathway?

YET1 shares functional similarities with components of the Guided Entry of Tail-anchored proteins (GET) pathway. While YET1 itself is not directly mentioned as a core GET component, it may function alongside proteins like GET1, which are required for the insertion of tail-anchored (TA) membrane proteins into the ER. The GET pathway is essential in both yeast and mammals for proper targeting of these specialized membrane proteins . Similar to how G1IP interacts with AtGET1 in plants, YET1 may form complexes with other ER membrane proteins to facilitate protein insertion or folding. These protein-protein interactions are often detectable through techniques such as rBiFC (ratiometric Bimolecular Fluorescence Complementation) or co-immunoprecipitation .

Why is S. cerevisiae a preferred model organism for studying YET1 and other ER proteins?

S. cerevisiae is exceptionally amenable to genetic manipulation, making it an ideal system for studying ER membrane proteins like YET1. The yeast genome has been extensively characterized through large-scale sequencing efforts of over 1,011 isolates, providing a robust foundation for comparative genomics . Additionally, S. cerevisiae offers several advantages for recombinant protein expression: it performs eukaryotic post-translational modifications, has well-established secretion pathways, and can be easily engineered to optimize protein production . For ER membrane proteins specifically, yeast provides a eukaryotic environment that mimics the native context of these proteins while allowing for controlled experimental conditions and relatively simple genetic modifications.

What are the most effective methods for cloning and expressing recombinant YET1 in S. cerevisiae?

For successful recombinant expression of YET1, researchers should consider the following methodological approach:

  • Gene amplification: Clone the YET1 gene using PCR with primers containing appropriate restriction sites (such as BstB1 and Xho1), incorporating a Kozak consensus sequence for optimal expression .

  • Vector construction: Ligate the amplified gene into an expression vector like pGAPZαC, which provides constitutive expression under the GAP promoter .

  • Transformation: Linearize the recombinant plasmid with appropriate restriction enzymes (such as AvrII) and transform into S. cerevisiae using electroporation .

  • Selection: Identify positive transformants using antibiotic selection (e.g., Zeocin) and confirm successful integration using PCR .

  • Expression verification: Confirm protein expression using Western blotting with appropriate antibodies or epitope tags (such as His-tag) .

This methodological approach has been successfully implemented for other recombinant proteins in S. cerevisiae and can be adapted for YET1 expression.

How can protein-protein interactions of YET1 be effectively studied in vivo?

To investigate YET1's interactions with other proteins, researchers can employ multiple complementary approaches:

  • Ratiometric Bimolecular Fluorescence Complementation (rBiFC): This technique allows visualization of protein-protein interactions in living cells. By fusing YET1 and its potential interaction partners to complementary fragments of a fluorescent protein (like YFP), researchers can detect interactions through fluorescence signal reconstitution .

  • Co-immunoprecipitation (co-IP): Developing Gateway-compatible co-IP vectors enables high constitutive gene coexpression in yeast, allowing for detection of protein complexes. This method is particularly valuable for detecting interactions that may depend on the presence of third proteins, as demonstrated with G1IP and AtGET3a interactions requiring AtGET1 .

  • IP-MS (Immunoprecipitation-Mass Spectrometry): This approach can identify novel interaction partners and is especially useful for discovering previously unknown components of protein complexes .

Each method has specific advantages, and combining multiple approaches provides more robust evidence of true interactions while revealing their contextual dependencies.

What genetic modification techniques are most suitable for studying YET1 function?

Several genetic approaches can be employed to study YET1 function:

  • Gene deletion: Creating YET1 knockout strains using homologous recombination to assess phenotypic consequences.

  • Temperature-sensitive mutations: Engineering conditional mutations (similar to rot1-2) that impair protein function at restrictive temperatures while maintaining functionality at permissive temperatures .

  • Overexpression systems: Using strong constitutive promoters (like GAP) or inducible promoters to increase YET1 expression and assess gain-of-function effects .

  • Tagged versions: Creating epitope-tagged versions of YET1 for detection and purification while preserving protein function .

  • Complementation assays: Testing whether YET1 can functionally replace orthologs in other species, as demonstrated for G1IP complementing yeast GET pathway receptor mutants .

When designing these genetic manipulations, researchers should consider the potential for pleiotropy and confirm phenotypes through complementation studies to establish causality.

How can YET1 be engineered to improve recombinant protein expression in biotechnology applications?

Engineering YET1 for improved recombinant protein expression requires a strategic approach:

  • Promoter optimization: Replace the native YET1 promoter with stronger promoters like GAP for constitutive expression or methanol-inducible promoters for controlled induction .

  • Signal sequence engineering: Optimize the alpha-mating factor or other signal peptides to enhance secretion efficiency of YET1-dependent proteins .

  • Codon optimization: Adjust codon usage to match highly expressed yeast genes, improving translation efficiency.

  • Modification of interaction domains: Engineer YET1 to enhance its chaperone function by modifying regions that interact with substrate proteins, based on insights from similar chaperones like Rot1 .

  • Co-expression with synergistic factors: Express YET1 alongside complementary chaperones (like BiP) that might cooperate in facilitating protein folding .

These approaches should be validated through comparative expression studies measuring both yield and functional quality of target proteins.

How does YET1 function compare across different S. cerevisiae strains with diverse genomic backgrounds?

The function of YET1 may vary significantly across different S. cerevisiae strains due to genomic diversity. Large-scale population genomic surveys of 1,011 S. cerevisiae isolates have revealed extensive genetic diversity and complex population structure in this yeast . This diversity manifests in several ways relevant to YET1 function:

  • Single Nucleotide Polymorphisms (SNPs): Wild isolates primarily evolve through SNP accumulation, which may affect YET1 coding sequences or regulatory regions .

  • Copy Number Variations: Domesticated yeast isolates show high variation in ploidy, aneuploidy, and genome content, potentially affecting YET1 gene dosage .

  • Loss of Heterozygosity: This represents an essential source of inter-individual variation in this mainly asexual species and could impact YET1 allelic diversity .

  • Strain origin effects: Genomic analyses support a single 'out-of-China' origin for S. cerevisiae, followed by several independent domestication events, which may have selected for different YET1 functionalities in various ecological niches .

When studying YET1, researchers should consider these strain-specific variations and potentially validate findings across multiple genetic backgrounds.

What computational tools are available for analyzing YET1 within the context of the S. cerevisiae proteome?

Several specialized computational tools can assist researchers studying YET1:

  • YETI (Yeast Exploration Tool Integrator): Though sharing a similar name to the protein of interest, this bioinformatics tool enables integrated visualization and analysis of functional genomic data sets from S. cerevisiae . Researchers can use YETI to analyze expression patterns, protein-protein interactions, and functional associations of YET1.

  • Interactome analysis tools: Software like INTEGRATOR and MiSink Plugin for Cytoscape allow researchers to visualize and analyze protein interaction networks involving YET1 .

  • SPrCY (Structural Predictions in the Saccharomyces cerevisiae): This tool enables comparison of structural predictions for yeast proteins, helping researchers understand YET1's structural features .

  • Localization databases: Resources focusing on protein localization can help confirm and analyze YET1's ER membrane localization within the broader context of the yeast proteome .

These computational resources can be accessed via web interfaces or downloaded under license for more customized analyses.

What phenotypic effects might be expected in YET1 mutants compared to wild-type S. cerevisiae?

Based on studies of similar ER membrane proteins, YET1 mutations would likely produce the following phenotypic effects:

PhenotypeWild-typeYET1 MutantMeasurement Method
Growth rateNormal doubling timeExtended lag phase, longer doubling timeGrowth curve analysis (OD600 measurement)
Stress toleranceNormal growth under ER stressIncreased sensitivity to ER stressorsSpot assays with tunicamycin or DTT
Protein secretionEfficient secretion of native proteinsReduced secretion of specific proteinsQuantification of reporter proteins in culture medium
ER-associated degradationNormal ERAD functionAccelerated degradation of YET1-dependent proteinsPulse-chase analysis of protein stability
Unfolded protein responseLow basal UPR activityConstitutively activated UPRRT-PCR of UPR target genes

As observed with the rot1-2 temperature-sensitive mutation, YET1 mutations might cause accelerated degradation of specific proteins in the secretory pathway via ER-associated degradation, resulting in decreased cellular levels of these proteins . The affected proteins might include both soluble and membrane proteins with various topologies, without necessarily sharing structural similarities .

How can researchers differentiate between direct and indirect effects of YET1 on protein folding?

Differentiating between direct and indirect effects of YET1 on protein folding requires a multi-faceted experimental approach:

  • Physical interaction studies: Demonstrate direct, physical, and potentially transient interaction between YET1 and substrate proteins using techniques like co-immunoprecipitation or crosslinking followed by mass spectrometry .

  • In vitro reconstitution: Purify recombinant YET1 and test its ability to prevent aggregation of denatured proteins in vitro, similar to studies with Rot1 that exhibited antiaggregation activity .

  • Temporal analysis: Examine the timing of YET1 association with substrates during their folding process to determine if interaction occurs during early folding steps (suggesting direct effects).

  • Mutational analysis: Create YET1 variants with impaired function (similar to rot1-2) and assess their impact on specific substrate folding to establish structure-function relationships .

  • Cooperative chaperone analysis: Investigate whether YET1 works alongside other chaperones (like BiP) by determining if substrates can simultaneously associate with both YET1 and other folding factors .

These approaches collectively help distinguish direct chaperone activity from indirect effects on the ER folding environment.

What statistical approaches are most appropriate for analyzing YET1 genome-wide association studies?

For genome-wide association studies (GWAS) involving YET1, researchers should consider these statistical approaches:

  • Variant identification: Prioritize analysis of copy-number changes over single nucleotide polymorphisms, as copy-number variations typically have greater phenotypic effects in yeast, as demonstrated in large-scale genomic studies .

  • Frequency analysis: Be aware that most functional SNPs in S. cerevisiae occur at very low frequencies in the population, requiring larger sample sizes for detection .

  • Loss of heterozygosity (LOH) analysis: Include specific statistical methods to detect and analyze LOH events, as these represent an essential source of inter-individual variation in this mainly asexual species .

  • Population structure correction: Implement statistical corrections for population structure, particularly important given S. cerevisiae's complex evolutionary history with a single 'out-of-China' origin followed by multiple domestication events .

  • Multi-trait analysis: Consider analyzing multiple phenotypes simultaneously, as YET1's effects on protein folding may manifest across several related traits.

When conducting these analyses, researchers should use appropriate multiple testing corrections and validate findings through targeted follow-up experiments.

What strategies can address poor expression of recombinant YET1 in S. cerevisiae?

When encountering poor expression of recombinant YET1, researchers can implement these methodological solutions:

  • Vector optimization: Ensure the expression vector contains appropriate elements for yeast expression, including a strong promoter (GAP), efficient terminator, and yeast-compatible selection markers .

  • Codon optimization: Adjust the coding sequence to match S. cerevisiae codon usage preferences, potentially increasing translation efficiency.

  • Signal sequence verification: If attempting secreted expression, confirm that the signal sequence (e.g., alpha-mating factor) is correctly fused to YET1 without disrupting the reading frame .

  • Strain selection: Test expression in multiple S. cerevisiae strains, as expression efficiency can vary significantly between genetic backgrounds .

  • Growth conditions: Optimize culture conditions including temperature, medium composition, and induction parameters if using an inducible system.

  • Verification methods: Use multiple detection methods, as Western blotting with an anti-His tag may confirm expression that might be missed by other techniques .

If expression remains problematic, consider expressing segments of YET1 rather than the full protein to identify troublesome regions.

How can researchers overcome challenges in detecting protein-protein interactions involving YET1?

Detection of YET1 protein interactions can be challenging, requiring specific strategies:

  • Context-dependent interactions: As seen with G1IP and AtGET3a, some interactions only occur in the presence of additional proteins. Therefore, ensure all necessary components are present in the experimental system .

  • Complementary approaches: Combine multiple interaction detection methods (rBiFC, co-IP, and IP-MS) to overcome limitations of individual techniques .

  • Transient interaction considerations: For transient interactions, employ crosslinking approaches or proximity-based labeling techniques (BioID, APEX) that can capture fleeting associations.

  • Control experiments: Include appropriate positive and negative controls in each experiment, as demonstrated in the G1IP studies where interaction was detected only in WT and not in the Atget1-2 mutant background .

  • Expression level adjustment: Modulate protein expression levels to avoid artifacts from overexpression while ensuring sufficient abundance for detection.

  • Subcellular localization verification: Confirm that both YET1 and potential interaction partners properly localize to the ER membrane to rule out false negatives due to mislocalization.

These approaches collectively increase the likelihood of detecting genuine interactions while minimizing false positives and negatives.

What are the critical considerations when designing genetic manipulation experiments to study YET1 function?

When designing genetic manipulation experiments for YET1 functional studies, researchers should consider:

  • Essential gene status: Determine whether YET1 is essential (like Rot1) before attempting knockout strategies, as deletion of essential genes requires conditional approaches .

  • Temperature-sensitive mutations: If YET1 is essential, develop temperature-sensitive alleles that maintain function at permissive temperatures while failing at restrictive temperatures, enabling controlled functional studies .

  • Complementation controls: Include complementation experiments with wild-type YET1 to confirm that observed phenotypes are directly due to YET1 disruption rather than secondary effects.

  • Tag position effects: When creating tagged versions, test both N- and C-terminal tags, as improper tag placement may disrupt membrane insertion or protein function.

  • Background strain consideration: Select genetic backgrounds carefully, as the effects of YET1 manipulation may vary across different S. cerevisiae strains with diverse genomic content .

  • Cross-species complementation: Consider testing whether YET1 can complement defects in orthologs from other species to gain evolutionary insights, similar to tests performed with G1IP complementing yeast GET pathway receptor mutants .

These considerations help ensure that genetic manipulations yield interpretable results that accurately reflect YET1's biological functions.

How might systems biology approaches advance our understanding of YET1's role in the ER protein quality control network?

Systems biology approaches offer powerful methods to contextualize YET1 within broader cellular networks:

  • Integrative omics: Combine transcriptomics, proteomics, and metabolomics data to map YET1's position within the ER quality control network, revealing how it influences global cellular processes.

  • Network modeling: Develop mathematical models of the ER folding environment that incorporate YET1 and its interactions, predicting system-level responses to perturbations.

  • Synthetic genetic arrays: Perform genome-wide synthetic genetic interaction screens with YET1 mutants to identify functional relationships with other genes .

  • Computational prediction tools: Utilize tools like YETI to integrate diverse data types and predict novel functions or interactions of YET1 .

  • Evolutionary analysis: Leverage the extensive genomic data from 1,011 S. cerevisiae isolates to analyze YET1 sequence conservation and variation across strains and correlate these with phenotypic differences .

These approaches collectively would provide a more comprehensive understanding of YET1's functions beyond what can be learned from reductionist approaches alone.

What potential applications exist for engineered YET1 variants in biotechnology?

Engineered YET1 variants could have valuable biotechnology applications:

  • Enhanced protein production: YET1 variants with improved chaperone activity could increase yields of difficult-to-express recombinant proteins in yeast expression systems .

  • Stress-resistant strains: Engineering YET1 to better handle ER stress could create yeast strains with enhanced resistance to industrial stressors like furfural and HMF, important for biofuel production .

  • Targeted folding assistance: Develop YET1 variants with modified substrate specificity to assist folding of particular protein classes that are challenging to produce recombinantly.

  • Biosensor development: Create fusion proteins combining YET1 with reporter domains that signal ER stress levels, useful for monitoring production processes.

  • Therapeutic protein production: Optimize YET1 to facilitate proper folding of complex therapeutic proteins with multiple disulfide bonds or glycosylation sites, improving their production in yeast systems .

These applications leverage YET1's natural role in protein folding to address challenges in biotechnological protein production.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.