Recombinant Saccharomyces cerevisiae ER-derived vesicles protein ERV14 (ERV14)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Saccharomyces cerevisiae ER-derived Vesicles Protein ERV14 (ERV14)

Saccharomyces cerevisiae ER-derived vesicles protein ERV14, commonly referred to as Erv14p, is a conserved integral membrane protein that plays a crucial role in the early secretory pathway in yeast . Belonging to a family of cargo receptors, Erv14p is essential for the selection and export of transmembrane proteins from the endoplasmic reticulum (ER) . It is localized to COPII-coated vesicles and is involved in vesicle formation and the incorporation of specific secretory cargo .

Functional Role of ERV14

Erv14p facilitates the transport of specific proteins from the ER to the Golgi apparatus by interacting with the COPII coat complex . This interaction is crucial for packaging cargo proteins into COPII vesicles, which are then transported to the Golgi .

Key functions of ERV14:

  • Cargo Selection: Erv14p is required for the selective packaging of transmembrane proteins, such as Axl2p, into COPII vesicles .

  • Vesicle Formation: It participates in the formation of COPII vesicles, which are essential for protein transport from the ER .

  • Protein Trafficking: Erv14p ensures the correct localization of proteins to their target destinations, such as the cell surface .

ERV14 and COPII Vesicles

Erv14p interacts genetically and physically with subunits of the COPII coat, which is necessary for the export of secretory proteins from the ER . This interaction depends on conserved residues within a cytoplasmically exposed loop domain of Erv14p .

  • Erv14p is enriched in COPII vesicles, indicating its direct involvement in the COPII-mediated transport pathway .

  • Mutations in the loop region of Erv14p can disrupt its interaction with the COPII coat, leading to the accumulation of Erv14p-cargo complexes in the ER .

Impact of ERV14 on Mycelial Growth

Research indicates that ERV14 influences mycelial growth and protein secretion, highlighting its broader role in cellular function .

  • Deletion of ERV14 in certain fungal strains leads to a reduced number of conidial peduncles and defective conidial heads .

  • The absence of ERV14 delays spore germination and results in abnormal mycelial development .

Phosphorylation of ERV14

Phosphorylation of Erv14p at specific sites, such as serine 134 (S134), plays a regulatory role in its function and trafficking .

  • Mimicking phosphorylation at S134 prevents the incorporation of Erv14p into COPII vesicles .

  • Mutations affecting phosphorylation can alter ER structure and affect the localization of plasma membrane transporters .

ERV14 and Sporulation

During sporulation in Saccharomyces cerevisiae, Erv14p is required for prospore membrane formation . Deletion of ERV14 results in misshapen prospore membranes, indicating its role in this developmental process .

  • Erv14p influences the localization of proteins, such as Sma2p, which is essential for prospore membrane morphology .

  • Overexpression of the ERV14 paralog ERV15 can suppress sporulation defects in erv14 cells .

ERV14 Interactions

Erv14p interacts with several proteins involved in ER-to-Golgi transport and other cellular processes :

ProteinDescription
Erv25Endoplasmic reticulum vesicle protein 25; Member of the p24 family involved in ER to Golgi transport
Svp26Integral membrane protein of the early Golgi apparatus and ER; involved in COP II vesicle transport
Erv29Protein localized to COPII-coated vesicles; involved in vesicle formation and incorporation of specific secretory cargo
Sec24Protein transport protein SEC24; Component of the Sec23p-Sec24p heterodimer of the COPII vesicle coat
Erp1Protein ERP1; Member of the p24 family involved in ER to Golgi transport; forms heterotrimeric complex with Erp2p, Emp24p, and Erv25p
Got1Homodimeric protein that is packaged into COPII vesicles; cycles between the ER and Golgi
Emp24Endosomal protein P24B; Component of the p24 complex; role in misfolded protein quality control
Axl2Integral plasma membrane protein; required for axial budding in haploid cells
Emp47Protein EMP47; Integral membrane component of ER-derived COPII-coated vesicles
Nha1Na+/H+ antiporter; involved in sodium and potassium efflux through the plasma membrane

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ERV14; YGL054C; ER-derived vesicles protein ERV14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-138
Protein Length
Full Length of Mature Protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
ERV14
Target Protein Sequence
GAWLFILAVVVNCINLFGQVHFTILYADLEADYINPIELCSKVNKLITPEAALHGALSLL FLLNGYWFVFLLNLPVLAYNLNKIYNKVQLLDATEIFRTLGKHKRESFLKLGFHLLMFFF YLYRMIMALIAESGDDF
Uniprot No.

Target Background

Function
ERV14 regulates the export of the bud site and axial growth sites selection protein AXL2, and potentially other secretory proteins, from the endoplasmic reticulum via COPII-coated vesicles. It appears essential for the axial budding pattern in haploid cells.
Gene References Into Functions
  1. Mutations in the C-terminal acidic motif of ScErv14 or OsCNIH1 did not affect the localization of these cargo receptors; however, it altered the proper targeting of the plasma membrane transporters Nha1p, Pdr12p, and Qdr2p. PMID: 28723420
  2. Erv14 interaction with a novel cargo-binding surface on Sec24 is crucial for efficient trafficking of all its client proteins. Some clients also interact with an adjacent cargo-binding domain of Sec24, suggesting a dual interaction mechanism between cargo and coat. PMID: 25619760
  3. Erv14 deletion results in altered localization of various proteins. PMID: 22629230
Database Links

KEGG: sce:YGL054C

STRING: 4932.YGL054C

Protein Families
Cornichon family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Note=Resides in the endoplasmic and Golgi compartments, and then packaged into endoplasmic reticulum derived vesicles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.