Recombinant Saccharomyces cerevisiae ER-derived vesicles protein ERV15 (ERV15)

Shipped with Ice Packs
In Stock

Description

Biological Function

ERV15 operates within the ER export machinery with the following roles:

  • COPII Cargo Receptor: Facilitates selective packaging of transmembrane proteins into COPII vesicles for transport from the ER to the Golgi .

  • Genetic Redundancy: Shares functional overlap with paralog ERV14 (resulting from whole-genome duplication), enabling partial compensation in knockout strains .

  • Developmental Regulation: Critical during sporulation for prospore membrane formation; double deletion of ERV14 and ERV15 blocks nuclear engulfment and plasma membrane protein trafficking .

3.1. Role in Sporulation

ERV15 overexpression rescues sporulation defects in erv14Δ mutants, restoring:

  • Proper localization of Sma2p (prospore membrane protein)

  • ER export of plasma membrane proteins (e.g., Sso1p t-SNARE)

3.2. Secretory Pathway Engineering

While not directly studied in recombinant ERV15, related strategies for optimizing yeast secretory pathways include:

  • Chaperone Co-expression: Overexpression of Kar2p (BiP) and Pdi1p enhances folding efficiency of ER-translocated proteins .

  • Vesicle Trafficking Modifications: Engineering COPII components (e.g., Sec61p) improves recombinant protein yields .

Applications in Biotechnology

Recombinant ERV15 is utilized in:

  • Vesicle Trafficking Studies: As a model cargo receptor to dissect ER-Golgi transport mechanisms .

  • Protein Interaction Screens: BioGRID reports 158 interactions, including COPII components (Sec23p, Sec24p) and plasma membrane transporters .

  • Recombinant Protein Production Systems: Insights from ERV15/ERV14 functional studies inform strain engineering to boost secretory capacity .

Research Limitations and Future Directions

  • Functional Redundancy: ERV15’s overlap with ERV14 complicates phenotype analysis in single knockouts .

  • Glycosylation Challenges: Native yeast hypermannosylation may limit therapeutic applications unless engineered .

  • Opportunities: CRISPR-based multiplex editing could enhance ERV15’s utility in secretory pathway optimization .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
ERV15; YBR210W; YBR1457; ER-derived vesicles protein ERV15
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-142
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
ERV15
Target Protein Sequence
MSGTGLSLFVTGLILNCLNSICQIYFTILYGDLEADYINSIELCKRVNRLSVPEAILQAF ISALFLFNGYWFVFLLNVPVLAYNASKVYKKTHLLDATDIFRKLGRCKIECFLKLGFYLL IFFFYFYRMVTALLENDANLIS
Uniprot No.

Target Background

Database Links

KEGG: sce:YBR210W

STRING: 4932.YBR210W

Protein Families
Cornichon family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is ERV15 and how does it relate to other ER-vesicle proteins in Saccharomyces cerevisiae?

ERV15 (ER-vesicle protein of 15 kD) belongs to a family of membrane-bound polypeptides found in COPII-coated ER-derived transport vesicles from Saccharomyces cerevisiae. It is structurally and functionally related to Erv14p, which is an integral membrane protein encoded on yeast chromosome VII and shares sequence identity with the Drosophila cornichon gene product . While Erv14p has been characterized in detail, ERV15 appears in genomic analyses as a related protein that has been targeted for disruption in experimental procedures using the TRP1 gene in multistep procedures .

What are the predicted structural characteristics of ERV15?

Based on similarities to Erv14p, ERV15 is likely an integral membrane protein that spans the lipid bilayer multiple times. Erv14p, for instance, is predicted to span the membrane three times and is resistant to carbonate extraction, indicating strong membrane association . Researchers investigating ERV15 should consider similar membrane association patterns when designing extraction and purification protocols, employing techniques that effectively solubilize integral membrane proteins.

What is the subcellular localization pattern of ERV15?

While specific localization data for ERV15 is limited in the provided research, related proteins such as Erv14p show distinct localization patterns. Erv14p has been found to localize predominantly to the ER (approximately 70%) with the remainder (approximately 30%) in the Golgi compartment based on subcellular fractionation studies . This distribution pattern is similar to other vesicle proteins such as Emp24p and Erv25p that cycle between the ER and Golgi compartments. Researchers studying ERV15 should employ similar fractionation techniques on sucrose gradients to determine its precise localization.

What are the recommended methods for studying ERV15 incorporation into COPII-coated vesicles?

For investigating ERV15 incorporation into COPII-coated vesicles, researchers should implement in vitro budding assays similar to those used for Erv14p characterization. This typically involves:

  • Preparation of ER-enriched microsomes from yeast strains expressing epitope-tagged ERV15

  • Incubation of these microsomes with purified COPII components (Sar1p, Sec23p/24p complex, and Sec13p/31p complex)

  • Isolation of budded vesicles by differential centrifugation

  • Analysis of protein content by immunoblotting

In studies with Erv14p, this approach demonstrated approximately 12% incorporation efficiency into COPII vesicles, comparable to other characterized vesicle proteins like Sec22p and Erv25p . The budding reaction should include appropriate controls without COPII proteins to demonstrate specificity of packaging.

How can researchers effectively tag ERV15 without disrupting its function?

Based on successful approaches with related proteins, researchers should consider:

  • C-terminal epitope tagging with HA or similar small epitopes that minimally interfere with membrane topology

  • Genomic integration of the tag sequence to maintain native expression levels

  • Verification of functionality through complementation tests in ERV15 deletion strains

  • Confirmation of proper localization using immunofluorescence and subcellular fractionation

For epitope-tagged versions of Erv14p, researchers have successfully used HA tags that allowed for detection while maintaining protein function . Similar strategies should be applicable to ERV15 studies.

What statistical approaches are most appropriate for analyzing ERV15 functional data?

For robust analysis of ERV15 functional data, researchers should employ a combination of statistical methods:

  • Analysis of variance (ANOVA) for comparing multiple experimental conditions

  • Non-parametric tests (e.g., Wilcoxon, Kolmogorov-Smirnov) when data doesn't meet normality assumptions

  • Regression models to identify relationships between ERV15 expression/function and phenotypic outcomes

  • Bootstrap and permutation techniques for datasets with limited sample sizes

How can researchers design experiments to elucidate potential cargo selectivity of ERV15?

To investigate cargo selectivity of ERV15, researchers should design experiments that:

  • Generate ERV15 deletion strains (erv15Δ) using targeted gene disruption techniques

  • Assess transport kinetics of various secretory proteins in wild-type versus erv15Δ strains

  • Analyze potential accumulation of specific cargo proteins in the ER of erv15Δ cells

  • Perform co-immunoprecipitation studies to identify direct interactions between ERV15 and potential cargo proteins

This methodological approach mirrors successful studies with Erv14p, which identified Axl2p as a specific cargo dependent on Erv14p for efficient ER export . In Erv14p-deficient cells, Axl2p accumulated in the ER while other secretory proteins were transported at wild-type rates, demonstrating cargo selectivity. Similar cargo-specific effects might be observed for ERV15.

How do ERV15 and ERV14 functions compare in vesicular transport?

Based on available research, ERV15 likely shares functional similarities with ERV14, but with distinct cargo specificities. Researchers investigating this comparison should:

  • Generate single (erv14Δ, erv15Δ) and double (erv14Δ erv15Δ) deletion strains

  • Compare growth phenotypes and secretory protein transport in these strains

  • Perform complementation studies to determine if overexpression of one protein can compensate for the absence of the other

  • Analyze specific cargo proteins to identify those dependent on either or both proteins

The functional overlap analysis should pay particular attention to polarity-related phenotypes, as Erv14p deficiency leads to bud site selection defects due to impaired Axl2p transport . Similar or complementary effects might be observed with ERV15 manipulation.

What experimental approaches best elucidate the relationship between ERV15 and the COPII coat machinery?

To investigate ERV15 interactions with the COPII coat machinery, researchers should implement:

  • In vitro binding assays with purified COPII components (particularly the Sec23p/24p cargo recognition complex)

  • Site-directed mutagenesis of putative COPII binding motifs in ERV15

  • Fluorescence microscopy with dual-labeled cells to visualize co-localization of ERV15 with COPII coat proteins at ER exit sites

  • Crosslinking studies to capture transient interactions during vesicle formation

These approaches would help determine whether ERV15, like other ER-vesicle proteins, functions as a cargo receptor that cycles between the ER and Golgi compartments, potentially facilitating the export of specific transmembrane cargoes .

How should researchers analyze quantitative data from ERV15 functional studies?

For robust quantitative analysis of ERV15 functional studies, researchers should:

The selection of analytical methods should be guided by the experimental design, and researchers should use statistical packages like R to implement these approaches . For complex phenotypes, quantitative fitness analysis (QFA) approaches mentioned in relation to ERV15 studies provide a framework for robust interpretation .

What are the recommended approaches for analyzing ERV15 membrane association and topology?

To analyze ERV15 membrane association and topology, researchers should implement a systematic approach:

  • Sequential membrane extraction with increasingly harsh conditions:

    • Buffer control

    • High salt (e.g., 2M NaCl) to release peripherally associated proteins

    • Alkaline extraction (e.g., 0.1M Na2CO3, pH 11) to release lumenal and loosely associated membrane proteins

    • Detergent treatment (e.g., 1% Triton X-100) to solubilize integral membrane proteins

  • Protease protection assays with and without membrane permeabilization to determine which regions of the protein are accessible

  • Site-directed mutagenesis of potential transmembrane domains followed by localization and functional studies

This systematic approach mirrors successful studies with Erv14p, which determined it to be an integral membrane protein resistant to carbonate extraction but solubilized by detergent treatment .

How might researchers investigate potential evolutionary conservation of ERV15 function across species?

To investigate evolutionary conservation of ERV15 function, researchers should:

  • Perform comparative genomic analyses to identify homologs in other fungal species and higher eukaryotes

  • Conduct complementation studies with identified homologs in S. cerevisiae erv15Δ strains

  • Analyze protein sequence conservation, particularly in functional domains and motifs

  • Implement heterologous expression studies to determine if the S. cerevisiae ERV15 can function in other organisms

This approach would build upon observations with Erv14p, which shares sequence identity with the Drosophila cornichon gene product, suggesting conservation of function between yeast and higher eukaryotes in mechanisms producing cell polarity .

What experimental design would best address potential redundancy between ERV15 and related proteins?

To address potential functional redundancy, researchers should design experiments that:

  • Generate a comprehensive set of single, double, and multiple deletions of ER-vesicle proteins

  • Analyze growth phenotypes, secretory pathway function, and cellular morphology across this deletion collection

  • Perform genome-wide synthetic genetic array analysis with erv15Δ to identify genes with related or compensatory functions

  • Utilize quantitative proteomics to identify changes in the composition of COPII vesicles in various deletion backgrounds

This systematic approach would help delineate the specific roles of ERV15 within the broader context of ER-to-Golgi transport and identify potential backup mechanisms that might compensate for its loss.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.