Recombinant Saccharomyces cerevisiae ER-derived vesicles protein ERV29 (ERV29)

Shipped with Ice Packs
In Stock

Description

Mechanism of Action in ER Export

ERV29 facilitates selective packaging of soluble secretory cargo into COPII vesicles:

  • ER-ESCAPE Motif Recognition: Binds amino-terminal tripeptides (e.g., APV, AVM) on cargo proteins like pro-α-factor and amylase to prioritize their ER export .

  • COPII Interaction: Collaborates with SEC24 paralogs to recruit COPII coat components, enabling vesicle formation .

  • Functional Conservation: Human Surf4 (ERV29 ortholog) rescues ER trafficking defects in ERV29-deficient yeast, confirming evolutionary conservation .

Recombinant ERV29 in Protein Secretion Engineering

Overexpression of recombinant ERV29 enhances secretory capacity in yeast:

  • Amylase Production: ERV29 overexpression in S. cerevisiae increased amylase secretion by 20–40% compared to wild-type strains .

  • Bulk Flow vs. Receptor-Mediated Export:

    ParameterERV29 Wild-Typeerv29Δ Mutant
    ER Export Rate (ESCargo)Rapid (10–20 min)Slow (bulk flow)
    Secretion EfficiencyHighReduced by ~70%
    Data from fluorescence tracking and immunoblot assays .
  • Stress Mitigation: ERV29 overexpression reduces ER oxidative stress by improving cargo flux, lowering reactive oxygen species (ROS) levels during heterologous protein production .

Functional Insights from Genetic Studies

  • Carboxypeptidase Y Trafficking: ERV29 deletion disrupts carboxypeptidase Y transport from the ER to Golgi, confirming its role in vacuolar enzyme maturation .

  • Cargo Saturation: ERV29-dependent export is saturable, with trafficking efficiency dependent on receptor-to-cargo ratios .

Biotechnological Applications

Recombinant ERV29 is leveraged to optimize secretory pathways:

  • ESCargo System: A synthetic fluorescent secretory cargo (e.g., DsRed-APV-FKBP) relies on ERV29 for rapid ER export, enabling real-time trafficking studies in yeast, mammalian cells, and Drosophila .

  • Strain Engineering: Combining ERV29 overexpression with retrograde trafficking enhancers (e.g., COG5) further improves secretion but requires balanced expression to avoid metabolic burden .

Evolutionary and Orthologous Relevance

ERV29’s human ortholog, Surf4, shares functional homology:

  • Both recognize N-terminal tripeptide motifs (ER-ESCAPE/Cardin-Weintraub) .

  • Surf4 rescues ER export defects in ERV29-null yeast, underscoring conserved mechanisms in eukaryotic secretion .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly specify them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery timelines, please consult your local distributors.
Note: All protein shipments are standardly packed with blue ice packs. If you require dry ice packaging, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. For long-term storage at -20°C/-80°C, we recommend adding 5-50% glycerol (final concentration) and aliquoting. Our default final glycerol concentration is 50%, serving as a reference for your convenience.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms exhibit a shelf life of 6 months at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. To avoid compromising the quality, avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have specific tag type requirements, please communicate these to us. We will prioritize developing the specified tag based on your request.
Synonyms
ERV29; YGR284C; ER-derived vesicles protein ERV29
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
ERV29
Target Protein Sequence
MSYRGPIGNFGGMPMSSSQGPYSGGAQFRSNQNQSTSGILKQWKHSFEKFASRIEGLTDN AVVYKLKPYIPSLSRFFIVATFYEDSFRILSQWSDQIFYLNKWKHYPYFFVVVFLVVVTV SMLIGASLLVLRKQTNYATGVLCACVISQALVYGLFTGSSFVLRNFSVIGGLLIAFSDSI VQNKTTFGMLPELNSKNDKAKGYLLFAGRILIVLMFIAFTFSKSWFTVVLTIIGTICFAI GYKTKFASIMLGLILTFYNITLNNYWFYNNTKRDFLKYEFYQNLSIIGGLLLVTNTGAGE LSVDEKKKIY
Uniprot No.

Target Background

Function
ERV29 is a constituent of COPII-coated endoplasmic reticulum-derived transport vesicles. It plays a crucial role in the efficient transport of a subset of secretory proteins to the Golgi apparatus. The C-terminal di-lysine motif is essential for its exit from the endoplasmic reticulum. ERV29 is directly involved in packaging glycosylated pro-alpha-factor into COPII vesicles. Additionally, it facilitates retrograde transport from the Golgi to the endoplasmic reticulum.
Gene References Into Functions
  1. Erv29p possesses four transmembrane domains with both termini exposed to the cytosol. Two luminal loops may contain a recognition site for hydrophobic export signals on soluble cargo PMID: 17520482
Database Links

KEGG: sce:YGR284C

STRING: 4932.YGR284C

Protein Families
SURF4 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is ERV29 and what is its primary function in yeast cells?

ERV29 is a conserved transmembrane protein in Saccharomyces cerevisiae that functions as a cargo receptor for soluble secretory proteins within the endoplasmic reticulum (ER). The primary function of ERV29 is to facilitate the export of specific soluble cargo proteins from the ER by packaging them into COPII (Coat Protein Complex II) vesicles. ERV29 was initially identified as being directly required for packaging glycosylated pro-alpha-factor (gpalphaf) into COPII vesicles in Saccharomyces cerevisiae . This receptor-mediated export mechanism significantly accelerates protein transport compared to the slower bulk flow process that occurs in the absence of cargo receptors. ERV29 binds to specific signal sequences on cargo proteins, creating a physical link between the soluble cargo and the COPII coat components, thus ensuring efficient incorporation of cargo into vesicles budding from the ER membrane . As an integral component of the cell's secretory pathway, ERV29 plays a crucial role in maintaining proper protein trafficking and cellular homeostasis.

How does ERV29 recognize its cargo proteins?

ERV29 recognizes specific short peptide sequences on cargo proteins, with a particular affinity for N-terminal tripeptide signals. The most well-characterized recognition motif is the tripeptide APV (Alanine-Proline-Valine), which when fused to the N-terminus of a protein, confers rapid transport from the ER to the Golgi apparatus . This recognition mechanism appears to be conserved across species, as the mammalian homolog SURF4 recognizes similar signals. In addition to the APV motif, ERV29/SURF4 can recognize what are termed ER-ESCAPE (ER-Exit by Soluble Cargo using Amino-terminal Peptide Encoding) signals that are revealed at the N-terminus after signal peptide cleavage . The recognition process involves direct physical interaction between ERV29 and its cargo clients, which has been demonstrated through techniques such as crosslinking and co-immunoprecipitation experiments . The ERV29-cargo complex formation is a crucial step that allows the cargo to be properly packaged into COPII vesicles, thus enabling efficient export from the ER. The specificity of this interaction ensures that only properly folded proteins with the correct targeting signals are transported forward in the secretory pathway.

How does the absence of ERV29 affect protein trafficking in yeast?

The absence of ERV29 significantly impairs the efficiency of protein transport from the ER for its specific cargo clients. In ERV29 deletion mutants (erv29Δ), cargo proteins that normally depend on this receptor for efficient export become retained in the ER for extended periods, and their secretion rates are dramatically reduced . Experimental evidence demonstrates that in wild-type cells containing ERV29, fluorescent secretory cargo proteins are rapidly exported from the ER, with fluorescence signals diminishing significantly within 10 minutes and becoming undetectable after 20 minutes following induced disaggregation . In contrast, in erv29Δ cells, the fluorescence persists in the ER throughout the entire observation period, indicating severe retention of cargo . Immunoblot analysis of culture media further confirms that secretion of ERV29-dependent cargo occurs rapidly in wild-type strains but proceeds much more slowly in erv29Δ strains . This dramatic difference occurs because in the absence of ERV29, cargo proteins can only exit the ER through the non-selective and much slower bulk flow mechanism, rather than the receptor-mediated selective transport. Additionally, ERV29 deletion can exacerbate trafficking defects when combined with mutations in other trafficking components, as demonstrated by its genetic interaction with ERP1, where the erv29Δ mutation enhanced the processing defect of Gas1p observed in erp1Δ cells .

What is the relationship between ERV29 and its mammalian homolog SURF4?

ERV29 in Saccharomyces cerevisiae and SURF4 in mammalian cells are homologous proteins that perform analogous functions as cargo receptors in the early secretory pathway. Both proteins facilitate the export of soluble secretory proteins from the ER by recognizing specific signal sequences on their client proteins and mediating their incorporation into COPII vesicles . The recognition mechanisms appear to be conserved, as both ERV29 and SURF4 recognize similar N-terminal peptide signals, including the ER-ESCAPE motifs . Research has shown that SURF4, like ERV29, drives the traffic of diverse secretory cargo proteins and interacts with components of the COPII coat, specifically the cargo adaptor SEC24 . The molecular mechanism of cargo recognition by SURF4 has been explored in greater detail, revealing that it employs at least two distinct mechanisms: recognizing Cardin-Weintraub (CW) motifs on clients via a putative lumenal α-helix, and binding N-terminal ER-ESCAPE signals through an unknown mechanism . SURF4 itself interacts with the B-site of SEC24A, which is consistent with its role in the secretion of specific clients like proprotein convertase substilisin/kexin type 9 (PCSK9) . This functional conservation across species highlights the fundamental importance of receptor-mediated cargo export in eukaryotic cell biology and suggests that findings about ERV29 in yeast can provide valuable insights into SURF4 function in mammalian systems.

How can ERV29 be utilized in developing regulatable secretory cargo systems?

ERV29 has been instrumental in developing advanced regulatable secretory cargo systems for studying membrane trafficking in diverse model organisms. Researchers have created an innovative tool called ESCargo (Erv29/Surf4-dependent Secretory Cargo), which consists of a fusion protein containing an ER signal sequence, the ERV29-binding tripeptide APV, a glycosylation signal, a fluorescent protein (DsRed-Express2), and an aggregation domain (FKBP RD(C22V)) . This ingenious design allows the cargo to form aggregates in the ER lumen that can be rapidly disaggregated by adding a small molecule ligand (SLF), generating a synchronized wave of fluorescent cargo that can be tracked as it moves through the secretory pathway . The ESCargo system provides several methodological advantages over previously developed regulatable secretory cargoes, which were often difficult to use or specific for a single model organism. The key innovation is the incorporation of the APV tripeptide, which is recognized by ERV29/Surf4, conferring rapid transport from the ER to the Golgi. This system has been successfully demonstrated not only in yeast cells but also in cultured mammalian cells, Drosophila cells, and the ciliate Tetrahymena thermophila, highlighting its versatility across different model organisms . By choosing appropriate ER signal sequences and expression vectors, researchers can adapt this technology to study secretory pathway dynamics in their specific experimental systems, making it a valuable tool for the cell biology research community.

What experimental approaches can be used to study ERV29-cargo interactions?

Several sophisticated experimental approaches have been developed to study the interactions between ERV29 and its cargo proteins. One powerful technique involves the use of site-specific crosslinking to detect direct physical interactions between ERV29/SURF4 and its clients. This approach utilizes amber STOP codon suppression to introduce photo-crosslinkable amino acids like p-benzoyl-L-phenylalanine (Bpa) at specific positions within the cargo protein . Upon UV irradiation, Bpa forms covalent bonds with adjacent amino acids on nearby proteins, creating stable adducts that can be isolated and analyzed by immunoprecipitation and SDS-PAGE . This method has successfully demonstrated the direct interaction between SURF4 and its client Cab45, providing insights into the binding interface . Another effective approach is the implementation of fluorescent cargo tracking systems, such as the ESCargo tool, which allows real-time visualization of cargo movement through the secretory pathway in live cells . By comparing the trafficking kinetics in wild-type and erv29Δ cells, researchers can quantify the contribution of ERV29 to cargo export efficiency . Additionally, in vitro reconstitution assays using purified components have been employed to demonstrate the direct requirement of ERV29 for cargo packaging into COPII vesicles . Immunoblot analysis of culture media can provide quantitative measurements of secretion rates for different cargo proteins in the presence or absence of ERV29 . Finally, genetic interaction studies, where ERV29 deletions are combined with mutations in other trafficking components, can reveal functional relationships within the secretory pathway network .

What is the significance of ERV29 in protein secretion engineering applications?

ERV29 has emerged as a significant target for protein secretion engineering in Saccharomyces cerevisiae, particularly for improving the production of recombinant proteins. Engineering the protein secretory pathway is crucial for enhancing the capacity of yeast as a cell factory for recombinant protein production . Studies have shown that overexpression of ERV29 can improve the secretion of heterologous proteins like amylase while reducing intracellular retention . This effect is likely due to ERV29's role in facilitating the efficient export of soluble proteins from the ER, which can be a rate-limiting step in the secretory pathway. The improvement in secretion efficiency is particularly valuable for industrial and pharmaceutical applications where high yields of secreted proteins are desired. Furthermore, understanding the cargo recognition mechanisms of ERV29 has enabled the development of strategies to enhance the secretion of recombinant proteins by adding ERV29-binding signals to their sequences . This approach transforms poorly secreted proteins into preferred cargo for the secretory pathway. Research has also revealed that ERV29 can have synergistic effects with other secretory pathway modifications, particularly those involved in endosome-to-Golgi trafficking, suggesting that combined engineering approaches targeting multiple steps in the secretory pathway may yield even greater improvements in protein secretion . These findings highlight the potential of ERV29 as a key target in the comprehensive engineering of yeast for enhanced protein production capabilities.

How does the ERV29-dependent cargo export mechanism relate to COPII vesicle formation?

The ERV29-dependent cargo export mechanism is intricately connected to COPII vesicle formation at the ER membrane. COPII vesicles are composed of five core proteins (Sar1, Sec23, Sec24, Sec13, and Sec31) that assemble on the ER membrane to drive vesicle budding and cargo selection . ERV29 functions as a transmembrane cargo receptor that links soluble secretory proteins in the ER lumen to this COPII coat machinery . Research has revealed that ERV29 and its mammalian homolog SURF4 interact specifically with SEC24, which is the primary cargo-selecting component of the COPII coat . This interaction occurs through defined binding sites on SEC24, with SURF4 particularly interacting with the B-site of SEC24A . This selective interaction with specific SEC24 paralogs may contribute to the diversity and specificity of cargo export mechanisms. Additionally, genetic studies have identified ERV29 as one of the "core" bypass-of-sec-thirteen (BST) genes, indicating that deletion of ERV29 can partially compensate for the loss of the COPII component Sec13 . This suggests a complex relationship where ERV29 and its bound cargo may influence the physical properties of the ER membrane and the mechanics of COPII vesicle formation. One proposed model suggests that the asymmetric distribution of cargo molecules bound to ERV29 could alter membrane curvature properties, which becomes particularly relevant when considering that COPII vesicles must adopt a specific curvature to form properly . These findings highlight how ERV29-mediated cargo selection is not merely a passive sorting process but actively influences the mechanics and efficiency of vesicle formation at the ER membrane.

What are the key considerations for designing experiments using ERV29 as a research tool?

When designing experiments using ERV29 as a research tool, several critical considerations must be addressed to ensure robust and interpretable results. First, researchers must carefully consider the genetic background of their yeast strains. As demonstrated in published studies, strains with deletions of drug transporter regulators (such as PDR1 and PDR3) may be necessary when using small molecule-based regulatable cargo systems to prevent drug efflux and maintain consistent intracellular drug concentrations . Additionally, certain genetic modifications like vps10-104 may be required to prevent diversion of fluorescent proteins to the vacuole by the sortilin homologue Vps10 . When comparing wild-type and erv29Δ strains, isogenic backgrounds are essential to attribute observed differences specifically to ERV29 function. Second, the choice of cargo protein and its fusion tags requires careful planning. The ESCargo system, for example, includes specific components that enable its functionality: a cleavable ER signal sequence, the ERV29-binding tripeptide APV, a glycosylation signal, a fluorescent protein, and an aggregation domain . Modifying any of these elements could affect the system's performance. Third, experimental timing is crucial, particularly for kinetic studies of protein trafficking. Since ERV29-mediated export is much faster than bulk flow, time points must be appropriately spaced to capture the relevant dynamics. Fourth, the detection methods must be sensitive enough to distinguish between different trafficking rates and locations. Fluorescence microscopy, immunoblotting, and biochemical fractionation each provide complementary information. Finally, researchers should consider the potential pleiotropic effects of ERV29 manipulation, as it may affect multiple cargo proteins and interact with various components of the secretory pathway.

How can mutational analysis be applied to study ERV29 function and specificity?

Mutational analysis provides a powerful approach to dissect the molecular mechanisms underlying ERV29 function and cargo specificity. Researchers can target either ERV29 itself or its cargo proteins to understand their interaction. When targeting ERV29, systematic mutagenesis of different domains can identify regions critical for cargo binding, COPII coat interaction, or proper localization within the ER. Particular attention should be paid to conserved residues between ERV29 and its homologs like SURF4, as these often represent functionally important sites. Reciprocal mutations in cargo proteins can elucidate the precise recognition motifs required for ERV29 binding. For example, altering the APV tripeptide to other amino acid combinations can determine the sequence specificity of the interaction . Structure-guided mutagenesis, informed by homology models or structural predictions, can test hypotheses about the binding interface. For the mammalian homolog SURF4, research has shown that placing crosslinkable amino acids at specific positions can identify direct contact points with cargo proteins . Functional complementation assays, where mutant versions of ERV29 are introduced into erv29Δ strains and assessed for their ability to restore normal trafficking, can validate the importance of specific residues or domains. Quantitative measurements of binding affinity between ERV29 variants and cargo proteins using techniques like surface plasmon resonance or microscale thermophoresis can provide insights into how mutations affect interaction strength. Finally, combining mutations in ERV29 with alterations in other trafficking components can reveal genetic interactions that illuminate functional relationships within the secretory pathway network.

What in vitro systems can be developed to study ERV29-mediated cargo packaging?

In vitro systems offer controlled environments to dissect the molecular mechanisms of ERV29-mediated cargo packaging into COPII vesicles. Several approaches can be developed based on existing methodologies in the field. One established approach involves reconstituting COPII vesicle budding from ER-enriched microsomes in the presence of purified COPII components, GTP, and an ATP regeneration system . By comparing vesicle formation and cargo packaging efficiency using microsomes derived from wild-type and erv29Δ strains, researchers can directly assess ERV29's contribution to the process. This system can be further refined by adding purified recombinant ERV29 to erv29Δ microsomes to attempt functional complementation. Another powerful approach is to develop liposome-based systems where purified ERV29 is reconstituted into artificial membrane vesicles along with fluorescently labeled cargo proteins. When combined with purified COPII components, this minimal system can reveal the sufficiency of ERV29 for cargo packaging in the absence of other cellular factors. Site-specific crosslinking techniques can be incorporated into in vitro translation systems to capture transient interactions between ERV29 and its cargo during the translocation and packaging process . This approach has successfully demonstrated direct interactions between the mammalian homolog SURF4 and its clients. For structural studies, detergent-solubilized ERV29-cargo complexes isolated from ER-derived vesicles can be analyzed using cryo-electron microscopy or X-ray crystallography to determine binding interfaces at atomic resolution. Finally, single-molecule fluorescence techniques could be applied to visualize the dynamics of individual ERV29-cargo complexes during COPII vesicle formation in real-time.

How can advanced imaging techniques be applied to visualize ERV29-dependent trafficking?

Advanced imaging techniques offer powerful approaches to visualize and quantify ERV29-dependent trafficking events with high spatial and temporal resolution. Super-resolution microscopy methods such as structured illumination microscopy (SIM), stimulated emission depletion (STED), or photoactivated localization microscopy (PALM) can overcome the diffraction limit of conventional microscopy, enabling the visualization of individual COPII vesicles (60-90 nm in diameter) and their cargo content. These techniques can reveal the nanoscale organization of ERV29 within ER exit sites and its colocalization with specific cargo proteins. For dynamic studies, the ESCargo system provides an excellent tool that can be combined with high-speed confocal microscopy to track cargo movement in real-time after triggered release from the ER . Spinning disk confocal microscopy is particularly well-suited for capturing rapid trafficking events with minimal photobleaching. Sophisticated image analysis algorithms can be applied to automatically track vesicle movement and quantify trafficking kinetics. Fluorescence resonance energy transfer (FRET) techniques can detect direct interactions between appropriately tagged ERV29 and its cargo proteins in living cells, providing insights into the dynamics of complex formation and dissociation during trafficking. Multi-color imaging with spectrally distinct fluorophores can simultaneously visualize multiple components of the trafficking machinery (e.g., ERV29, cargo, COPII coat proteins, and Golgi markers) to understand their spatiotemporal relationships. For long-term imaging, light-sheet microscopy offers reduced phototoxicity, allowing extended observation of trafficking events without compromising cell viability. Finally, correlative light and electron microscopy (CLEM) can combine the molecular specificity of fluorescence imaging with the ultrastructural detail of electron microscopy to localize ERV29 and its cargo within the context of cellular membranes and organelles.

What are emerging applications of ERV29 in synthetic biology and biotechnology?

ERV29 is emerging as a valuable tool in synthetic biology and biotechnology applications, particularly for enhancing protein secretion and developing novel research tools. One of the most promising applications is in metabolic engineering of Saccharomyces cerevisiae for improved production of recombinant proteins and biopharmaceuticals. Overexpression of ERV29 has been shown to enhance secretion of heterologous proteins like amylase while reducing intracellular retention . This effect can be further amplified when combined with modifications to other secretory pathway components, creating synergistic improvements in secretion capacity . Another innovative application is the development of regulatable secretory cargo systems like ESCargo, which provides unprecedented control over protein trafficking for research purposes . This technology can be adapted for various model organisms and extends beyond basic research to potential applications in drug screening and disease modeling. The modular nature of the ERV29-binding motif (such as the APV tripeptide) makes it an attractive tool for synthetic biology approaches where protein localization and trafficking need to be precisely controlled . By fusing this motif to proteins of interest, researchers can enhance their secretion efficiency or direct them to specific compartments within the secretory pathway. Furthermore, understanding the molecular details of ERV29-cargo interactions opens possibilities for designing custom cargo receptors with altered specificity, potentially enabling selective enhancement of desired protein secretion while minimizing cellular stress. The conservation of ERV29/SURF4 function across species also suggests that insights gained from yeast studies can be translated to mammalian expression systems, which are crucial for production of complex therapeutic proteins . Finally, the role of ERV29 in protein quality control within the secretory pathway may be leveraged to develop strategies for improving the folding and secretion of challenging protein therapeutics that tend to aggregate or be retained in the ER.

What novel therapeutic targets might emerge from studies of the ERV29/SURF4 system?

Studies of the ERV29/SURF4 system have begun to reveal potential therapeutic targets with implications for various human diseases. The mammalian homolog SURF4 has been identified as a cargo receptor for several clinically relevant proteins, including proprotein convertase substilisin/kexin type 9 (PCSK9) , a key regulator of cholesterol metabolism. PCSK9 inhibitors have already proven effective in lowering LDL cholesterol and reducing cardiovascular risk, and understanding how SURF4 regulates PCSK9 secretion could potentially lead to novel therapeutic approaches for dyslipidemias. Modulating SURF4 function might offer a strategy to selectively influence the secretion of specific disease-associated proteins without broadly affecting the secretory pathway. The detailed molecular understanding of how SURF4 recognizes its clients through ER-ESCAPE motifs and Cardin-Weintraub (CW) motifs provides potential targets for small molecule or peptide-based interventions that could either enhance or inhibit specific cargo-receptor interactions. Given SURF4's role in protein quality control within the secretory pathway, it may also represent a target for diseases caused by protein misfolding and trafficking defects, such as certain lysosomal storage disorders or protein conformational diseases. In cancer biology, the secretory pathway is often upregulated to support the increased demand for protein production, and SURF4 might represent a vulnerability that could be exploited therapeutically in tumors that depend on efficient secretion. The evolutionarily conserved nature of the ERV29/SURF4 system makes yeast an excellent model for initial drug discovery efforts targeting this pathway, as findings in yeast can often be translated to mammalian systems . Furthermore, the development of tools like ESCargo provides platforms for high-throughput screening of compounds that modulate cargo receptor function, potentially accelerating the discovery of therapeutic candidates. As our understanding of the ERV29/SURF4 system continues to advance, additional connections to disease processes and therapeutic opportunities are likely to emerge, highlighting the translational potential of this fundamental research area.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.