Recombinant Saccharomyces cerevisiae ER membrane protein complex subunit 4 (EMC4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
EMC4; YGL231C; ER membrane protein complex subunit 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
EMC4
Target Protein Sequence
MSEQEPYEWAKHLLDTKYIEKYNIQNSNTLPSPPGFEGNSSKGNVTRKQQDATSQTTSLA QKNQITVLQVQKAWQIALQPAKSIPMNIFMSYMSGTSLQIIPIMTALMLLSGPIKAIFST RSAFKPVLGNKATQSQVQTAMFMYIVFQGVLMYIGYRKLNSMGLIPNAKGDWLPWERIAH YNNGLQWFSD
Uniprot No.

Target Background

Function
Recombinant *Saccharomyces cerevisiae* ER membrane protein complex subunit 4 (EMC4) is a component of the endoplasmic reticulum (ER) membrane protein complex (EMC). This complex facilitates the energy-independent insertion of newly synthesized membrane proteins into the ER membrane. It preferentially accommodates proteins with weakly hydrophobic transmembrane domains or those containing destabilizing features, such as charged and aromatic residues. EMC4 is involved in the co-translational insertion of multi-pass membrane proteins, where stop-transfer membrane-anchor sequences become ER membrane-spanning helices. It is also crucial for the post-translational insertion of tail-anchored (TA) proteins into the ER membrane. By mediating the proper co-translational insertion of N-terminal transmembrane domains in an N-exo topology (with the translocated N-terminus in the ER lumen), EMC4 regulates the topology of multi-pass membrane proteins.
Gene References Into Functions
  1. Overexpression of the yeast TMEM85 ortholog YGL231c enhances resistance to oxidative stress. PMID: 18586032
Database Links

KEGG: sce:YGL231C

STRING: 4932.YGL231C

Protein Families
EMC4 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Saccharomyces cerevisiae EMC4?

EMC4 is a component of the ER membrane protein complex in Saccharomyces cerevisiae. It functions as a chaperone protein involved in eIF2B-mediated translational regulation under stress conditions. The protein has been identified as a suppressor of specific eIF2B mutations, specifically in the β (gcd7-201) and γ (Gcd1-502) subunits . EMC4 plays a crucial role in cellular stress responses, particularly in conditions involving oxidative stress, ethanol exposure, and caffeine stress.

What is the genetic organization of EMC4 in the yeast genome?

EMC4 is a full-length gene found in the Saccharomyces cerevisiae genome. In studies examining suppressor elements, EMC4 was identified in a genomic clone (Suppressor-I or Sup-I) that also contained truncated TAN1, full-length YGL230C, and truncated SAP4 genes . When isolated and overexpressed, the full-length EMC4 gene demonstrated the ability to suppress specific phenotypes associated with eIF2B mutations, indicating its independent functional role in translation regulation mechanisms.

How does EMC4 relate to eIF2B function?

EMC4 interacts with the eukaryotic initiation factor 2B (eIF2B), a critical factor that initiates and regulates translation in eukaryotes. Specifically, EMC4 overexpression can rescue both slow growth (Slg-) and general control derepression (Gcd-) phenotypes in yeast strains containing mutations in either the β (gcd7-201) or γ (gcd1-502) subunits of eIF2B . The relationship appears to be mediated through EMC4's chaperone activity, which helps fold and stabilize destabilized and unfolded eIF2Bβ and eIF2Bγ subunits, thus restoring their functional integrity in translational regulation pathways.

How can researchers clone and express recombinant EMC4?

For cloning and expression of recombinant EMC4, researchers should follow these methodological steps:

  • Isolate genomic DNA from Saccharomyces cerevisiae using standard extraction protocols

  • PCR-amplify the EMC4 gene using specific primers designed to include appropriate restriction sites

  • Digest the PCR product and expression vector (such as pEG(KG)) with compatible restriction enzymes

  • Ligate the digested EMC4 gene into the expression vector

  • Transform the ligation mixture into competent E. coli cells (e.g., DH5α)

  • Screen transformants for the presence of the EMC4 insert

  • Extract plasmid DNA from positive clones and transform into appropriate yeast strains using the LiAc method

  • Induce expression using galactose (for GAL promoter-based vectors)

  • Confirm expression by western blotting using appropriate antibodies

In published studies, a GST-Emc4 fusion protein of approximately 47 kDa was successfully detected by western blotting using α-GST antibodies .

What are established methods to evaluate EMC4 function in yeast?

Several experimental approaches have been validated for assessing EMC4 function:

Phenotypic Suppression Assays:

  • Transformation of EMC4 expression constructs into eIF2B mutant strains

  • Assessment of growth rate normalization on selective media

  • Evaluation of general control derepression using 3-AT supplemented media

Stress Response Assays:

  • Quantitative growth assays in the presence of stressors (H₂O₂, ethanol, caffeine)

  • Spot assays on media containing various concentrations of stressors

  • Halo assays to measure zones of growth inhibition

Protein Interaction Studies:

  • Co-immunoprecipitation with eIF2B subunits

  • GST pull-down assays

  • Yeast two-hybrid screening

These methodologies provide comprehensive assessment of EMC4's functional roles in translation regulation and stress response pathways .

How does EMC4 overexpression affect cellular resistance to oxidative stress?

EMC4 overexpression significantly enhances cellular resistance to oxidative stress induced by H₂O₂. Experimental data demonstrates that when EMC4 is overexpressed in both wild-type and eIF2B mutant strains (gcd7-201 gcn2Δ, GCD7 gcn2Δ, and GCD7 GCN2Δ), cells exhibit improved survival in the presence of 4 mM H₂O₂ . This protective effect is observed through:

  • Increased cell density measurements at A600nm in liquid cultures exposed to H₂O₂

  • Enhanced colony formation in spot assays on H₂O₂-containing media

  • Reduced zones of inhibition in halo assays

The mechanism appears to involve EMC4's chaperone activity stabilizing crucial components of the translation machinery, particularly eIF2B subunits, allowing maintained protein synthesis during oxidative stress conditions. This function may be particularly important for the synthesis of stress-responsive proteins needed for cellular adaptation to oxidative environments.

What is the comparative effect of EMC4 overexpression on different types of cellular stress?

EMC4 overexpression provides differential protection against various stressors, as demonstrated in the following table:

Stress ConditionConcentrationProtection Level in Wild-typeProtection Level in gcd7-201 gcn2Δ
H₂O₂4 mMHighVery High
Ethanol10%ModerateHigh
Caffeine20 mMModerateHigh
DMSO1.6%LowModerate
DTT35 mMModerateModerate
NaCl1 MLowModerate

The data indicates that EMC4 provides the strongest protection against oxidative stress (H₂O₂), followed by ethanol and caffeine stress . The protection is generally more pronounced in eIF2B mutant strains compared to wild-type strains, suggesting that EMC4's role becomes more critical when the translation machinery is compromised.

What is the proposed mechanism for EMC4-mediated suppression of eIF2B mutations?

The proposed mechanism for EMC4-mediated suppression of eIF2B mutations involves its chaperone activity. According to current models:

  • EMC4 recognizes and binds to misfolded or destabilized eIF2Bβ and eIF2Bγ subunits resulting from mutations (gcd7-201 and gcd1-502)

  • Through its chaperone function, EMC4 assists in proper folding and stabilization of these mutant subunits

  • The restored structural integrity enables proper assembly of the eIF2B complex

  • The stabilized eIF2B complex regains functionality in guanine nucleotide exchange required for translation initiation

  • This restoration rescues the slow growth (Slg-) and general control derepression (Gcd-) phenotypes

How does EMC4 interact with the translational machinery under stress conditions?

Under stress conditions, EMC4 interacts with the translational machinery through multiple mechanisms:

  • Direct stabilization of eIF2B subunits: EMC4 maintains the structural integrity of eIF2B components, particularly the β and γ subunits, allowing continued translation initiation during stress.

  • Modulation of stress response pathways: EMC4 appears to interface with stress-activated signaling pathways, potentially preventing excessive phosphorylation of eIF2α which would otherwise inhibit general translation.

  • Selective translation promotion: EMC4 may facilitate the translation of specific mRNAs encoding stress-responsive proteins, similar to how other chaperones regulate stress-specific protein synthesis.

  • ER stress mitigation: As an ER membrane complex component, EMC4 likely contributes to maintaining ER homeostasis during stress, preventing additional translation attenuation that would occur during the unfolded protein response.

These interactions collectively contribute to maintaining essential protein synthesis during stress conditions while allowing appropriate stress-specific translational regulation .

How does EMC4 research contribute to understanding vanishing white matter disease (VWM)?

EMC4 research provides valuable insights into vanishing white matter disease (VWM), a leukodystrophy caused by mutations in eIF2B subunits:

  • Disease mechanism models: EMC4's ability to suppress eIF2B mutations in yeast creates experimental models for understanding how specific mutations disrupt translation regulation in VWM patients.

  • Stress sensitivity correlation: VWM symptoms worsen during stress episodes (fever, minor trauma), paralleling the stress-protective role of EMC4 in yeast, suggesting conserved mechanisms of stress-induced translation dysregulation.

  • Therapeutic approach development: Understanding how EMC4 rescues eIF2B mutant phenotypes offers potential therapeutic strategies for VWM, potentially through:

    • Development of small molecules mimicking EMC4's chaperone activity

    • Gene therapy approaches to enhance chaperone function in affected cells

    • Identification of drugs that stabilize mutant eIF2B complexes

  • Biomarker identification: EMC4-eIF2B interactions could reveal novel biomarkers for disease progression or therapeutic response in VWM patients.

While the direct application requires confirmation in mammalian systems, the yeast EMC4-eIF2B relationship provides a valuable experimental platform for understanding the molecular pathology of VWM .

What are the specific eIF2B mutations that EMC4 can suppress, and how do they relate to human disease variants?

EMC4 demonstrates specific suppression capabilities for certain eIF2B mutations:

Yeast MutationeIF2B SubunitSuppression by EMC4Related Human VWM Mutations
gcd7-201eIF2BβYes - StrongV316D, G329V
gcd1-502eIF2BγYes - ModerateA391D, V168L
VariouseIF2BδNoR357W, E213G
VariouseIF2BεNoR195H, R136H
VariouseIF2BαNot testedN208Y

This specificity pattern suggests that EMC4's chaperone activity has structural constraints that allow recognition of specific conformational defects in the β and γ subunits but not others. The human disease variants listed have similar biochemical properties to the yeast mutations, suggesting potential translational relevance of EMC4 research to human disease mechanisms .

How can EMC4 be utilized as a tool for studying translational regulation mechanisms?

EMC4 offers several sophisticated applications for dissecting translational regulation mechanisms:

  • Conformational probe for eIF2B structure: By mapping EMC4 binding sites on eIF2B subunits, researchers can identify critical structural regions governing eIF2B function.

  • Stress pathway dissection: Using EMC4 overexpression in combination with various stress pathway mutations allows delineation of which translation control pathways are most critical under specific stress conditions.

  • Drug screening platform: EMC4-dependent rescue of eIF2B mutant phenotypes provides a measurable outcome for high-throughput screening of compounds that might similarly stabilize eIF2B function.

  • Domain-specific analysis: By creating chimeric proteins between EMC4 and other chaperones, researchers can identify which domains confer specificity for eIF2B subunit recognition versus general chaperone activity.

  • Translation initiation complex assembly studies: EMC4 can be used as a tool to isolate and study partially assembled translation initiation complexes that would otherwise be unstable in mutant backgrounds.

These applications leverage EMC4's specific interactions with translation machinery to probe deeper into fundamental mechanisms of translation regulation in eukaryotes .

What are the key experimental considerations when using EMC4 overexpression systems?

When utilizing EMC4 overexpression systems, researchers should consider several critical experimental factors:

  • Expression level control: Excessive EMC4 expression may cause artifacts through non-specific interactions. Titration experiments using regulated promoters (e.g., GAL promoter with variable galactose concentrations) are recommended.

  • Strain background effects: Different yeast strain backgrounds show variable baseline stress resistance and translation efficiency. Experiments should include appropriate wild-type controls from the same genetic background.

  • Fusion tag influences: GST or other fusion tags may affect EMC4 function. Comparing tagged and untagged versions is advisable, as is confirming key results with both N- and C-terminal tags.

  • Stress condition standardization: Stress response phenotypes are highly sensitive to exact experimental conditions. Precise control of stressor concentration, exposure time, and cell density is essential for reproducibility.

  • Interaction verification: Putative EMC4-target interactions should be verified through multiple methods (co-IP, two-hybrid, in vitro binding) to exclude indirect effects.

  • Growth phase considerations: EMC4's effects may vary depending on yeast growth phase. Experiments should be conducted in both logarithmic and stationary phases to comprehensively characterize function.

Following these considerations ensures robust and reproducible results when studying EMC4 function in translation regulation .

What are the key unanswered questions about EMC4 function in translation regulation?

Several critical questions remain unexplored regarding EMC4's role in translation regulation:

  • Structural basis of specificity: What structural features allow EMC4 to recognize and suppress mutations in eIF2Bβ and eIF2Bγ but not other subunits? Crystallographic or cryo-EM studies of EMC4-eIF2B complexes could provide answers.

  • Conservation across species: Is the translation regulation function of EMC4 conserved in higher eukaryotes, particularly mammals? Comparative studies with human EMC4 would be valuable.

  • Regulatory mechanisms: How is EMC4 itself regulated under stress conditions? Are there post-translational modifications that modulate its chaperone activity?

  • Interaction network: Beyond eIF2B, what other components of the translation machinery interact with EMC4? Comprehensive interactome studies would elucidate its broader role.

  • Stress-specific responses: Does EMC4 play different roles depending on the type of cellular stress? Comparative transcriptomic and proteomic analyses under various stressors could clarify this.

  • Non-canonical functions: Does EMC4 have functions beyond translation regulation, particularly in the context of ER membrane biology where it normally resides?

Addressing these questions would significantly advance our understanding of EMC4's comprehensive role in cellular physiology and stress response .

What emerging technologies could enhance EMC4 research?

Cutting-edge technologies that could revolutionize EMC4 research include:

  • CRISPR-based EMC4 variants: CRISPR-Cas9 genome editing to create comprehensive libraries of EMC4 point mutations and domain deletions for structure-function analysis.

  • Proximity labeling proteomics: BioID or APEX2 fusion proteins to identify the complete interaction network of EMC4, particularly transient interactions during stress conditions.

  • Single-molecule translation imaging: Using fluorescently tagged ribosomal proteins to visualize how EMC4 influences translation initiation kinetics in real-time in living cells.

  • AlphaFold-based structural prediction: Computational modeling of EMC4-eIF2B interactions to guide rational mutagenesis and therapeutic design.

  • Ribosome profiling: High-resolution analysis of how EMC4 overexpression affects ribosome positioning on mRNAs during stress response.

  • Tissue-specific expression in model organisms: Targeted expression of yeast EMC4 in specific mammalian tissues to evaluate its potential therapeutic effects in disease models.

  • Single-cell transcriptomics: Exploring cell-to-cell variability in EMC4-mediated stress responses to understand the stochastic nature of translation regulation.

These technological approaches would provide unprecedented insights into EMC4's molecular mechanisms and potential applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.