Recombinant Saccharomyces cerevisiae Ergosterol biosynthetic protein 28 (ERG28)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its incorporation.
Synonyms
ERG28; BUD18; YER044C; Ergosterol biosynthetic protein 28
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-148
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
ERG28
Target Protein Sequence
MFSLQDVITTTKTTLAAMPKGYLPKWLLFISIVSVFNSIQTYVSGLELTRKVYERKPTET THLSARTFGTWTFISCVIRFYGAMYLNEPHIFELVFMSYMVALFHFGSELLIFRTCKLGK GFMGPLVVSTTSLVWMYKQREYYTGVAW
Uniprot No.

Target Background

Function
ERG28 functions as a scaffold protein, anchoring ERG25, ERG26, and ERG27 to the endoplasmic reticulum and potentially facilitating their interaction.
Gene References Into Functions
  1. Studies demonstrate an interaction between the endoplasmic reticulum membrane protein Erg28p and sterol biosynthetic proteins, suggesting that many, if not all, sterol biosynthetic proteins may exist as a large, tethered complex. PMID: 15995173
Database Links

KEGG: sce:YER044C

STRING: 4932.YER044C

Protein Families
ERG28 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is ERG28 and what is its primary function in yeast?

ERG28 is a non-catalytic protein involved in ergosterol biosynthesis in Saccharomyces cerevisiae. It functions primarily as an endoplasmic reticulum (ER) transmembrane protein that acts as a scaffold to tether the C-4 demethylation enzymatic complex . The protein plays a crucial role in organizing sterol biosynthetic enzymes into functional complexes, facilitating efficient ergosterol production in yeast cells . While ERG28 does not possess enzymatic activity itself, its absence significantly impairs ergosterol biosynthesis, demonstrating its essential role in this metabolic pathway.

How conserved is ERG28 across different species?

ERG28 is conserved from yeast to humans, though with notable structural differences . While the yeast protein contains two transmembrane domains, homologs in higher organisms possess four transmembrane domains and have acquired an ER retention/retrieval motif in the C-terminus . Despite this conservation, C. elegans ERG-28 shows only 22.2% identity (56.4% similarity) with the human homolog C14orf1 based on non-overlapping local alignment . This divergence suggests that while the protein's fundamental role in sterol metabolism is conserved, its specific functions and interactions may have evolved differently across species.

What phenotypes are observed in ERG28 knockout models?

In yeast, ERG28 knockout strains are not auxotrophic for ergosterol but exhibit significantly reduced growth rates and approximately 70% reduction in ergosterol synthesis compared to wild-type strains . These mutants also show a dramatic increase in C4-methylated and C4-keto sterols, suggesting a deficiency at the C4-demethylation step in ergosterol synthesis .

In mammalian cell models (Huh7 ERG28-KO cell lines), knockout results in reduced total cholesterol levels in sterol-depleted environments and a 60-75% reduction in the rate of cholesterol synthesis .

In C. elegans, erg-28 mutants exhibit phenotypes similar to slo-1 loss-of-function mutants, including ethanol-resistant locomotory behavior, due to impaired trafficking of SLO-1 BK channels to the plasma membrane .

How does ERG28 interact with other proteins in the sterol biosynthetic pathway?

ERG28 in S. cerevisiae interacts with multiple enzymes in the ergosterol biosynthetic pathway, serving as a scaffold to organize these enzymes into a functional complex. Using yeast two-hybrid systems and coimmunoprecipitation experiments, researchers have demonstrated that ERG28 interacts with the C-4 demethylation enzymes (Erg25p, Erg26p, Erg27p) as well as with Erg6p, Erg11p, and Erg1p .

The strength of these interactions varies, with reporter gene expression levels indicating that ERG28 associates most strongly with Erg27p, Erg25p, Erg11p, and Erg6p, and less strongly with Erg26p and Erg1p . These findings suggest a model where ERG28 tethers multiple enzymes involved in sterol biosynthesis, creating a large multienzyme complex that enhances pathway efficiency.

In mammals, ERG28 has been shown to interact with itself and two enzymes of cholesterol synthesis (NSDHL and SC4MOL) based on split luciferase system experiments . These interactions suggest that the scaffolding function of ERG28 is conserved across species despite sequence divergence.

What is the subcellular localization of ERG28 and how does it relate to its function?

ERG28 primarily localizes to the endoplasmic reticulum membrane . In C. elegans, ERG-28 contains a well-established consensus ER retrieval/retention motif (KKXX-COOH) at its C-terminus, which interacts with coat protein complex I (COPI) to mediate retrograde transport from the Golgi to the ER . This localization is critical for its function in organizing sterol biosynthetic enzymes, which are also predominantly ER-resident proteins.

Fluorescence microscopy studies with GFP-tagged ERG-28 in C. elegans revealed punctate structures along the neuronal processes, consistent with ER localization . In muscle cells, ERG-28 co-localizes with ER markers from the muscle interior to the plasma membrane . Some ERG-28 puncta exhibit mobility, suggesting that ERG-28 shuttles between ER and Golgi .

When the ER retention/retrieval motif is deleted (as in the cim16 allele lacking 7 amino acids at the C terminus), expression is significantly decreased and normal punctate structures are lost, indicating the importance of this motif for proper localization and stability .

How is ERG28 gene expression regulated at the transcriptional level?

In mammals, ERG28 transcription is primarily driven by the transcription factor SREBP-2, similar to most cholesterol synthesis enzymes . Analysis of the ERG28 promoter region has identified sterol-responsive elements (SREs) and cofactor binding sites that mediate this regulation .

Chromatin immunoprecipitation sequencing (ChIP-Seq) data from pravastatin-treated HepG2 cells confirms SREBP-2 binding in the ERG28 promoter . Additionally, putative SREs have been predicted in the -290/+10 ERG28 promoter region using matrix analyses of SRE sequences . Sp1 and NF-Y binding sites have also been identified in this promoter region using ConSite prediction tools .

This SREBP-2-mediated regulation places ERG28 within the broader regulatory network controlling cholesterol homeostasis, suggesting coordinated expression with other enzymes in the pathway.

What role does ERG28 play in protein trafficking beyond sterol metabolism?

Beyond its role in sterol metabolism, ERG28 has been implicated in protein trafficking. In C. elegans, ERG-28 promotes the trafficking of SLO-1 BK channels from the ER to the plasma membrane . In erg-28 mutants, SLO-1 is not efficiently trafficked to the plasma membrane and undergoes degradation, resulting in ethanol-resistant locomotory behavior characteristic of slo-1 loss-of-function mutants .

This finding suggests that ERG28 may have broader functions in cellular protein trafficking, potentially linking sterol metabolism with membrane protein transport. The mechanism by which ERG28 facilitates SLO-1 trafficking remains to be fully elucidated, but may involve effects on membrane composition or direct protein-protein interactions.

What expression systems are most effective for producing recombinant ERG28 protein?

Recombinant ERG28 protein from S. cerevisiae can be effectively expressed in E. coli expression systems . For optimal expression and purification, the following approaches are recommended:

  • Expression vector selection: Vectors containing strong promoters (T7, tac) with N-terminal His-tag for purification purposes

  • E. coli strain selection: BL21(DE3) or Rosetta strains are preferred for membrane protein expression

  • Induction conditions: IPTG concentration of 0.1-0.5 mM at lower temperatures (16-25°C) to enhance proper folding

  • Purification approach: Immobilized metal affinity chromatography (IMAC) using the His-tag, followed by size exclusion chromatography

The resulting recombinant protein can be stored as a lyophilized powder and reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol for long-term storage at -20°C/-80°C . Repeated freeze-thaw cycles should be avoided to maintain protein integrity.

What techniques are most effective for studying ERG28 protein interactions?

Several complementary techniques have proven effective for investigating ERG28 protein interactions:

  • Yeast two-hybrid systems: Specialized systems designed for membrane proteins have been successfully used to assess interactions between ERG28 and sterol biosynthetic enzymes . This approach allows for pairwise testing of binary interactions.

  • Coimmunoprecipitation (Co-IP): This technique has confirmed interactions between ERG28 and seven ergosterol biosynthetic enzymes in yeast . For Co-IP studies, epitope-tagged versions of ERG28 (e.g., FLAG, HA) can be used as bait to pull down interacting partners.

  • Split luciferase complementation assays: This approach has demonstrated interactions between ERG28 and itself, as well as with NSDHL and SC4MOL in mammalian systems . This method is particularly useful for detecting interactions in live cells.

  • Fluorescence microscopy: Colocalization studies using fluorescently tagged proteins (e.g., GFP-ERG28 with mCherry-tagged ER markers) can provide spatial information about protein interactions .

  • Bimolecular Fluorescence Complementation (BiFC): While not explicitly mentioned in the search results, this technique is well-suited for visualizing protein interactions in living cells and could be applied to ERG28 research.

TechniqueAdvantagesLimitationsApplication to ERG28
Yeast two-hybridSystematic screening of multiple interactionsMay produce false positives/negativesIdentified interactions with sterol biosynthetic enzymes
Co-IPDetects native protein complexesRequires high-quality antibodiesConfirmed seven interactions discovered in Y2H screens
Split luciferase assayQuantitative, works in live cellsRequires protein taggingDemonstrated ERG28 self-association and interaction with NSDHL/SC4MOL
Fluorescence microscopyProvides spatial informationLimited resolutionShowed ERG28 colocalization with ER markers

What methods are best for assessing ERG28 functional impact on sterol synthesis?

To evaluate ERG28's functional impact on sterol synthesis, researchers have employed several methodological approaches:

How do the functions of ERG28 differ between yeast, nematodes, and mammals?

ERG28 exhibits both conserved and divergent functions across species:

  • Yeast (S. cerevisiae):

    • Functions as a scaffold for ergosterol biosynthetic enzymes

    • Contains two transmembrane domains

    • Knockout reduces ergosterol synthesis by ~70%

    • Critical for efficient C4-demethylation in the ergosterol pathway

  • Nematodes (C. elegans):

    • Contains four transmembrane domains and an ER retention/retrieval motif

    • Functions in SLO-1 BK channel trafficking from ER to plasma membrane

    • Mutation results in ethanol-resistant locomotory behavior

    • Forms an operon with C14C10.5, which encodes a homolog of proteasome activator subunit 4

  • Mammals:

    • Contains four transmembrane domains

    • Involved in cholesterol synthesis, regulated by SREBP-2

    • Interacts with cholesterol synthesis enzymes NSDHL and SC4MOL

    • Knockout reduces total cholesterol levels and synthesis rates by 60-75%

These differences suggest that while the core function in sterol metabolism is conserved, ERG28 has acquired additional roles during evolution, particularly in protein trafficking and membrane organization in higher organisms.

How do structural differences in ERG28 relate to functional specialization across species?

The structural evolution of ERG28 across species relates to its functional specialization:

  • Transmembrane domain expansion: The increase from two transmembrane domains in yeast to four in higher organisms likely reflects additional interaction capabilities with a broader range of proteins .

  • Acquisition of ER retention/retrieval motif: Higher organisms' ERG28 proteins have gained a KKXX-COOH motif at the C-terminus, which interacts with COPI to ensure proper ER localization . This suggests tighter regulation of ERG28 localization in complex organisms.

  • Sequence divergence: Despite functional conservation, C. elegans ERG-28 shows only 22.2% identity with human homolog C14orf1 . This divergence may underlie species-specific interactions and functions.

  • Expression pattern differences: In C. elegans, ERG-28 is expressed in neurons, muscles, and intestine , whereas in yeast, its expression is more ubiquitous. This tissue-specific expression pattern in higher organisms suggests specialized functions in different cell types.

The acquisition of additional structural features in higher organisms correlates with expanded functional roles, including protein trafficking beyond sterol metabolism, highlighting how evolutionary changes in protein structure can drive functional diversification.

What is the potential role of ERG28 in neurological disorders?

The discovery that C. elegans ERG-28 regulates trafficking of SLO-1 BK channels, which are critical for neuronal excitability and neurotransmitter release , suggests potential implications for neurological disorders. BK channels play important roles in neuronal function, and their dysregulation has been linked to epilepsy, ataxia, and cognitive impairments.

Since ERG-28 promotes the trafficking of SLO-1 from the ER to the plasma membrane , defects in human ERG28 homolog (C14orf1) could potentially impact BK channel surface expression and function in neurons. This connection between ERG28 and ion channel trafficking represents an intriguing area for future research into the molecular mechanisms underlying certain neurological conditions.

How might ERG28 be exploited as a therapeutic target for cholesterol-related disorders?

Given ERG28's role in cholesterol synthesis in mammals , it represents a potential therapeutic target for cholesterol-related disorders. Unlike many other proteins in the cholesterol biosynthetic pathway, ERG28 is non-catalytic, offering unique advantages as a target:

  • Targeting ERG28 could modulate cholesterol synthesis without completely blocking the pathway, potentially resulting in fewer side effects than traditional statins.

  • The observed 60-75% reduction in cholesterol synthesis rates in ERG28-KO cells suggests that ERG28 inhibition could achieve clinically significant cholesterol lowering.

  • ERG28's role as a scaffold for multiple enzymes means that targeting it could simultaneously affect multiple steps in the pathway, potentially increasing therapeutic efficacy.

Future research should focus on developing small molecules or peptides that disrupt specific ERG28 protein interactions rather than completely eliminating the protein, allowing for more nuanced modulation of cholesterol synthesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.