Recombinant Saccharomyces cerevisiae Ethionine resistance-conferring protein 1 (ERC1)

Shipped with Ice Packs
In Stock

Description

Protein Characteristics and Classification

ERC1 is a transmembrane protein belonging to the MATE family within the multidrug/oligosaccharidyl-lipid/polysaccharide (MOP) exporter superfamily . Its primary function involves exporting toxic compounds, including ethionine, to mitigate intracellular toxicity .

Key Features

PropertyDetailsSource
Uniprot IDP38767
Gene NameYHR032W
Protein Length581 amino acids (full-length)
FamilyMATE (Multidrug and Toxin Extrusion)
Expression SystemRecombinant production in E. coli (His-tagged)
Storage Conditions-20°C for short-term; -80°C for long-term storage

Mechanism of Ethionine Resistance

ERC1 overexpression confers ethionine resistance by preventing the accumulation of toxic metabolites. Ethionine is structurally similar to methionine and incorporates into S-adenosylethionine (AdoEt), a toxic analog of S-adenosylmethionine (SAM) .

Mechanistic Insights

  1. Detoxification Pathway:

    • ERC1 likely exports ethionine or its metabolites (e.g., AdoEt) out of the cell, reducing intracellular toxicity .

    • Mutant strains lacking ERC1 fail to hydrolyze AdoEt efficiently, leading to its accumulation and growth inhibition .

  2. Impact on SAM Levels:

    • Overexpression of ERC1 increases intracellular SAM levels, suggesting a compensatory mechanism to counteract ethionine toxicity .

Recombinant ERC1 Production and Applications

Recombinant ERC1 is produced in E. coli for structural and functional studies. Key details include:

Genetic and Functional Evidence

  • Overexpression Studies:

    • Constitutive expression of ERC1 in S. cerevisiae strains enhances ethionine resistance and SAM accumulation .

  • Mutant Phenotypes:

    • et r2 mutants (defective in ERC1 function) show reduced AdoEt hydrolysis and impaired growth under ethionine stress .

Research Implications and Future Directions

ERC1 serves as a model for studying multidrug resistance and detoxification pathways in yeast. Its recombinant form enables:

  1. Drug Resistance Studies:

    • Investigating the substrate specificity of MATE transporters.

  2. Metabolic Engineering:

    • Engineering yeast strains for enhanced toxin tolerance in biotechnological applications.

  3. Structural Biology:

    • Elucidating the molecular basis of toxin recognition and transport.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on your purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type preference, please inform us, and we will prioritize its development accordingly.
Synonyms
ERC1; YHR032W; Ethionine resistance-conferring protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-581
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
Target Protein Sequence
MSKQFSHTTNDRRSSIIYSTSVGKAGLFTPADYIPQESEENLIEGEEQEGSEEEPSYTGN DDETEREGEYHSLLDANNSRTLQQEAWQQGYDSHDRKRLLDEERDLLIDNKLLSQHGNGG GDIESHGHGQAIGPDEEERPAEIANTWESAIESGQKISTTFKRETQVITMNALPLIFTFI LQNSLSLASIFSVSHLGTKELGGVTLGSMTANITGLAAIQGLCTCLDTLCAQAYGAKNYH LVGVLVQRCAVITILAFLPMMYVWFVWSEKILALMIPERELCALAANYLRVTAFGVPGFI LFECGKRFLQCQGIFHASTIVLFVCAPLNALMNYLLVWNDKIGIGYLGAPLSVVINYWLM TLGLLIYAMTTKHKERPLKCWNGIIPKEQAFKNWRKMINLAIPGVVMVEAEFLGFEVLTI FASHLGTDALGAQSIVATIASLAYQVPFSISVSTSTRVANFIGASLYDSCMITCRVSLLL SFVCSSMNMFVICRYKEQIASLFSTESAVVKMVVDTLPLLAFMQLFDAFNASTAGCLRGQ GRQKNRWVHQPSRILLPRCAHGICVSIPVSSGCRRLMVGYN
Uniprot No.

Target Background

Function
ERC1 (Ethionine resistance-conferring protein 1) is a probable transporter in *Saccharomyces cerevisiae* that plays a role in ethionine resistance. Overexpression of ERC1 leads to the accumulation of S-adenosylmethionine.
Database Links

KEGG: sce:YHR032W

STRING: 4932.YHR032W

Protein Families
Multi antimicrobial extrusion (MATE) (TC 2.A.66.1) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the primary function of ERC1 in Saccharomyces cerevisiae?

ERC1 in S. cerevisiae serves multiple cellular functions. Originally identified as conferring resistance to ethionine (a toxic analog of methionine), ERC1 has been demonstrated to play critical roles in:

  • Modulating the levels of S-adenosyl-methionine (SAM) and S-adenosyl-homocysteine (SAH) in the methionine cycle

  • Acting as a scaffold protein that facilitates the assembly of protein networks at the cell periphery

  • Contributing to cellular motility through the formation of dynamic condensates that recruit motility-related proteins

The protein's effects on SAM levels are particularly noteworthy, as SAM is a central metabolite that serves as the primary methyl donor for numerous cellular methylation reactions. ERC1 appears to function within genetic networks that include other regulatory elements like SLT2, a MAP kinase involved in cell wall integrity pathways .

How does ERC1 genetic variation affect yeast metabolism?

Genetic variation in ERC1 significantly impacts yeast metabolism, particularly affecting the methionine/SAM cycle. Research has identified:

  • An indel polymorphism in certain yeast strains (such as the RM strain) that causes a frameshift mutation, altering 37 residues and extending the peptide by 43 amino acids compared to the BY strain

  • This polymorphism creates quantitative trait loci (QTL) that influence SAM and SAH levels in yeast

  • When both ERC1 and the nearby SLT2 gene (approximately 3 kb apart) from the RM strain are transferred to the BY background, SAM levels increase significantly, though not to the levels observed in the original RM strain

  • Conversely, replacing both genes in the RM strain with BY alleles leads to significantly lower levels of both SAM and SAH

These findings suggest that while ERC1 polymorphisms play a substantial role in regulating SAM-cycle metabolites, additional unidentified genetic factors also contribute to the observed strain-dependent variation in these metabolite levels.

What is the molecular structure of ERC1 protein?

ERC1 exhibits a complex molecular structure that underlies its functional versatility:

  • Electron microscopy and single-molecule analysis have revealed that ERC1 forms parallel homodimers approximately 119 ± 18 nm in length

  • The protein contains extensive coiled-coil regions and a flexible, disordered N-terminus

  • The variable distance between the globular portions in different dimers suggests structural flexibility, particularly in the N-terminal region

  • The extended/partially disordered structure of ERC1 is supported by limited proteolysis experiments, which demonstrate higher sensitivity to proteases than structured proteins like vinculin

This structural organization, combining ordered regions with intrinsically disordered domains, enables ERC1 to function effectively as a scaffold protein that can undergo phase separation to form biomolecular condensates.

How does the intrinsically disordered region (IDR) of ERC1 contribute to its function?

The intrinsically disordered region (IDR) at the N-terminus of ERC1 plays crucial roles in the protein's function:

  • The N-terminal region of ERC1 (ERC1-N) forms cytoplasmic droplets with liquid-like behavior, while the C-terminal part (ERC1-C) does not

  • These ERC1-N droplets exhibit rapid fluorescence recovery after photobleaching (FRAP), with 62 ± 7% recovery and t₁/₂ = 3.0 ± 0.42 s, indicating faster exchange than observed for full-length ERC1

  • The IDR appears to modulate the phase separation properties of ERC1, contributing to the formation of biomolecular condensates in the cytoplasm

  • While not required for condensate formation per se, the N-terminal IDR seems important for stabilizing condensates needed to recruit interacting partners at specific cellular locations, such as the protruding edge of migrating cells

The ability of ERC1 to form liquid-like condensates represents a mechanism for spatiotemporal control of molecular assembly, particularly for organizing protein networks involved in cell motility at specific subcellular locations.

What are the recommended methods for studying ERC1 phase separation properties?

To effectively investigate ERC1 phase separation properties, researchers should consider several complementary approaches:

  • Fluorescence microscopy of tagged ERC1: Monitoring GFP-tagged ERC1 expression reveals that condensates appear 2-4 hours after transfection and increase in size and number over time. Importantly, condensation occurs only after ERC1 reaches a threshold concentration in the cytoplasm

  • Fusion and fission dynamics analysis: Time-lapse imaging to observe continuous shape changes, fusion, and fission events of ERC1 condensates provides insights into their liquid-like properties

  • Fluorescence Recovery After Photobleaching (FRAP):

    • Conduct full bleach of ERC1 condensates

    • Measure fluorescence recovery over time

    • Calculate mobile fraction (typically ~68% for full-length ERC1) and half-time of recovery (t₁/₂ = 5.6 ± 0.56 s for full-length ERC1)

    • Compare these parameters between full-length protein and truncation mutants to identify domains contributing to condensate dynamics

  • Domain deletion analysis: Creating truncation mutants (such as ERC1-N and ERC1-C) helps identify regions responsible for phase separation behavior. For example, experiments have shown that the N-terminal region forms liquid-like droplets while the C-terminal region does not

  • Co-localization studies: Determining which proteins are recruited to or excluded from ERC1 condensates provides functional insights. For instance, liprin-α1, LL5, and GIT proteins are specifically recruited to ERC1 condensates, while GAPDH and focal adhesion proteins such as α-actinin, talin, vinculin, and Src are excluded

These methodologies collectively provide a comprehensive characterization of ERC1 phase separation behavior and its functional implications.

How can I effectively design experiments to study the genetic variation in ERC1?

When investigating genetic variation in ERC1, consider the following experimental design strategies:

  • Allele replacement experiments:

    • Replace the native ERC1 allele with variants from different strain backgrounds

    • Include neighboring genes like SLT2 that may form functional haplotypes with ERC1

    • Measure phenotypic effects, such as metabolite levels or cellular behaviors

  • Metabolomics analysis:

    • Use liquid chromatography-tandem mass spectrometry (LC-MS/MS) to quantify metabolites affected by ERC1 variation

    • Focus particularly on SAM-cycle compounds (SAM, SAH)

    • Consider broader metabolic profiling to identify additional affected pathways

  • Polymorphism characterization:

    • Sequence ERC1 alleles from different strain backgrounds to identify relevant polymorphisms

    • Pay particular attention to indels that may cause frameshifts, as observed with the 43-amino acid extension in the RM strain

    • Use predictive tools to assess the functional impact of amino acid changes

  • Quantitative Trait Locus (QTL) analysis:

    • Cross strains with different ERC1 alleles

    • Analyze segregating progeny for metabolite levels or other phenotypes

    • Map QTLs to identify genetic factors that interact with ERC1 variation

  • Controls and validation:

    • Include both the original parental strains and the allele-replaced strains in analyses

    • Perform reciprocal replacements (e.g., BY→RM and RM→BY) to control for background effects

    • Validate findings with complementation tests or additional genetic manipulations

When designing these experiments, it's crucial to control for potential confounding factors such as expression levels, genetic background effects, and environmental conditions that might influence ERC1 function independently of the genetic variation being studied.

How does ERC1 contribute to the formation of biomolecular condensates in cellular contexts?

ERC1 contributes to biomolecular condensate formation through a sophisticated process dependent on concentration, structural properties, and protein-protein interactions:

  • Concentration-dependent phase separation:

    • ERC1 accumulates into cytoplasmic condensates in approximately 30% of transfected cells when expressed at sufficient levels

    • Condensates appear 2-4 hours after transfection and increase in size and number with time

    • A threshold concentration must be reached in the cytoplasm before condensation occurs

  • Domain-specific contributions:

    • The N-terminal region of ERC1 (ERC1-N) is sufficient to form cytoplasmic droplets with liquid-like properties

    • The C-terminal portion (ERC1-C) does not form condensates on its own

    • The intrinsically disordered region (IDR) in the N-terminus modulates the phase separation behavior

  • Dynamic properties of condensates:

    • ERC1 condensates exhibit continuous shape changes with fusion and fission events

    • FRAP experiments reveal rapid exchange between condensates and cytoplasm (t₁/₂ = 5.6 ± 0.56 s; 68% mobile fraction)

    • Truncated constructs like ERC1-N show even faster exchange rates (t₁/₂ = 3.0 ± 0.42 s)

  • Selective recruitment of partner proteins:

    • ERC1 condensates specifically recruit proteins involved in cell motility networks, including liprin-α1, LL5, and GIT proteins

    • Other cytosolic and focal adhesion proteins are excluded from these condensates

    • The central ERC-binding region (EBR) of liprin-α is necessary and sufficient for its recruitment to ERC1 condensates

These findings suggest that ERC1-mediated phase separation represents a mechanism for spatiotemporal organization of protein networks at specific cellular locations, particularly at the leading edge of migrating cells.

What methodological challenges exist when studying the relationship between ERC1 and SLT2 in metabolite regulation?

Studying the relationship between ERC1 and SLT2 in metabolite regulation presents several methodological challenges:

  • Genetic proximity complications:

    • ERC1 is located only 3 kb (approximately 1 cM) from SLT2, causing them to segregate together as a haplotype

    • This genetic linkage makes it difficult to separate their individual effects through conventional genetic approaches

    • Solution: Use precise gene replacement techniques to create strains where only one gene is replaced while maintaining the native allele of the other

  • Complex genetic interactions:

    • Even when both ERC1 and SLT2 from the RM strain are transferred to the BY background, SAM levels increase but remain lower than in the original RM strain

    • This suggests additional undetected loci also play roles in the observed metabolite variation

    • Solution: Perform comprehensive QTL mapping to identify all genetic factors contributing to the phenotype

  • Context-dependent effects:

    • The impact of genetic variants may differ depending on the strain background

    • Solution: Conduct reciprocal replacements in multiple strain backgrounds to assess context-dependency

  • Metabolite measurement challenges:

    • Accurate quantification of metabolites like SAM and SAH requires specialized techniques

    • Small changes in experimental conditions can affect metabolite levels

    • Solution: Employ robust LC-MS/MS methods with appropriate internal standards and technical replicates

  • Determining mechanistic connections:

    • While genetic evidence links these genes to metabolite levels, establishing the mechanistic connection between ERC1 function and SAM-cycle regulation remains challenging

    • Solution: Combine genetic approaches with biochemical assays, protein interaction studies, and metabolic flux analysis

To address these challenges, an integrated experimental approach is required, combining precise genetic manipulations, comprehensive metabolomic profiling, and detailed functional characterization of both ERC1 and SLT2.

How should contradictory findings about ERC1 function be reconciled in research?

When encountering contradictory findings about ERC1 function, researchers should systematically analyze potential sources of discrepancy and develop strategies to reconcile them:

  • Strain background differences:

    • Different S. cerevisiae strains contain distinct ERC1 alleles with potentially different functions

    • The BY and RM strains, for example, contain ERC1 variants with different effects on SAM metabolism

    • Solution: Always specify the exact strain background used and consider testing findings in multiple strain backgrounds

  • Expression level variations:

    • ERC1 function appears concentration-dependent, with phase separation occurring only above threshold levels

    • Inconsistent findings may result from differences in expression levels between studies

    • Solution: Quantify expression levels and correlate with observed phenotypes; use controlled expression systems

  • Contextual protein interactions:

    • ERC1 function depends on interactions with proteins like liprin-α1

    • The absence of key interaction partners in some experimental systems may lead to contradictory results

    • Solution: Map the protein interaction network in each experimental system and account for differences

  • Methodological differences:

    • Different assay conditions or measurement techniques may yield conflicting results

    • Solution: Standardize protocols between research groups and directly compare methods when discrepancies arise

  • Multifunctional nature of ERC1:

    • As a scaffold protein involved in both metabolism and cell motility, ERC1 likely has multiple functions that may be differentially observed depending on the experimental focus

    • Solution: Consider that seemingly contradictory findings may actually reflect different aspects of ERC1's multifunctional nature

Source of ContradictionAnalysis ApproachReconciliation Strategy
Strain backgroundSequence comparison of ERC1 allelesTest findings across multiple strains
Expression levelsQuantitative expression analysisUse controlled expression systems
Protein interactionsInteraction profilingMap relevant interaction networks
Methodological differencesProtocol comparisonStandardize methods between studies
Multiple functionsFunctional domain analysisRecognize context-specific functions

By systematically addressing these potential sources of contradiction, researchers can develop a more complete and nuanced understanding of ERC1 function.

What statistical approaches are most appropriate for analyzing ERC1-related phenotypic data?

When analyzing ERC1-related phenotypic data, researchers should consider several statistical approaches tailored to the specific experimental design and data characteristics:

  • For QTL mapping studies:

    • Employ interval mapping or composite interval mapping to identify genomic regions linked to ERC1-dependent phenotypes

    • Use permutation tests to establish significance thresholds for LOD scores

    • Consider mixed-model approaches that account for population structure in diverse yeast collections

  • For metabolomic data analysis:

    • Apply normalization techniques appropriate for mass spectrometry data

    • Use multivariate methods such as principal component analysis (PCA) or partial least squares discriminant analysis (PLS-DA) to identify patterns in metabolite profiles

    • Employ false discovery rate (FDR) correction for multiple hypothesis testing when analyzing many metabolites simultaneously

  • For condensate formation and dynamics:

    • Use regression analysis to correlate ERC1 expression levels with condensate formation

    • Apply curve-fitting approaches for FRAP data to extract parameters like mobile fraction and recovery half-time

    • Consider autocorrelation analysis for time-series data of condensate dynamics

  • For gene-gene interaction analysis:

    • Test for epistatic interactions using ANOVA with interaction terms

    • Apply Bayesian network analysis to infer causal relationships

    • Consider gene set enrichment analysis (GSEA) to identify pathways affected by ERC1 variation

  • For reproducibility and robustness:

    • Perform power analyses to determine appropriate sample sizes

    • Use bootstrapping or jackknife resampling to assess the stability of findings

    • Consider Bayesian approaches that incorporate prior knowledge when available

When dealing with complex phenotypes that may result from the combined effects of ERC1 and other genes, more sophisticated approaches such as systems genetics or network analysis may be particularly valuable. These methods can help untangle the complex relationships between genetic variation, molecular phenotypes (like metabolite levels), and higher-level cellular behaviors.

What are the unexplored aspects of ERC1 function in yeast cellular biology?

Despite significant advances in understanding ERC1, several critical aspects remain unexplored:

  • Regulatory mechanisms controlling ERC1 expression and activity:

    • How is ERC1 expression regulated in response to cellular conditions?

    • What post-translational modifications affect ERC1 function?

    • Are there condition-specific interaction partners that modulate ERC1 activity?

  • Connection to stress response pathways:

    • Potential links between ERC1 and the unfolded protein response (UPR) remain uninvestigated

    • ERC1's role in other stress response pathways, particularly those involving cell wall integrity and the SLT2 MAP kinase pathway, warrants deeper exploration

  • Evolutionary conservation and divergence:

    • Comparative analysis of ERC1 structure and function across fungal species

    • Identification of conserved functional domains versus species-specific adaptations

    • Potential roles in pathogenic versus non-pathogenic fungal species

  • Integration with metabolic networks:

    • While ERC1 affects SAM-cycle compounds, its broader impact on cellular metabolism remains poorly understood

    • Connections between ERC1-mediated phase separation and metabolic compartmentalization

    • Potential roles in metabolic adaptation to changing environmental conditions

  • Condensate composition and regulation:

    • Comprehensive proteomic analysis of ERC1 condensates under different conditions

    • Investigation of factors controlling condensate assembly and disassembly

    • Exploration of concentration-dependent versus signal-dependent condensate formation

These unexplored areas present significant opportunities for researchers to contribute novel insights into ERC1 biology and its roles in cellular function.

How might advanced imaging techniques enhance our understanding of ERC1 dynamics in living cells?

Advanced imaging techniques offer powerful approaches to illuminate ERC1 dynamics in living cells:

  • Super-resolution microscopy:

    • Techniques like PALM, STORM, or STED could reveal nanoscale organization within ERC1 condensates

    • Multi-color super-resolution imaging would allow precise spatial mapping of different proteins within condensates

    • These approaches could identify potential subdomains or organizational principles within the condensates

  • Live-cell single-molecule tracking:

    • Tracking individual ERC1 molecules would provide insights into diffusion rates, binding kinetics, and exchange dynamics

    • Comparison of molecule behavior inside versus outside condensates

    • Analysis of how mutations or interacting partners affect single-molecule dynamics

  • Fluorescence correlation spectroscopy (FCS):

    • Measurement of concentration fluctuations with high temporal resolution

    • Determination of diffusion coefficients and binding interactions

    • Analysis of concentration dependence of ERC1 phase separation behavior in living cells

  • Förster resonance energy transfer (FRET):

    • Investigation of protein-protein interactions within condensates

    • Analysis of conformational changes in ERC1 during condensate formation

    • Study of dynamic interactions between ERC1 and its partners like liprin-α1

  • Lattice light-sheet microscopy:

    • Low phototoxicity allows extended imaging of ERC1 dynamics in living cells

    • High spatiotemporal resolution permits detailed analysis of condensate formation, fusion, and movement

    • 3D visualization of condensate distribution throughout the cell volume

  • Optogenetic approaches:

    • Light-inducible ERC1 oligomerization to control condensate formation with precise spatiotemporal resolution

    • Investigation of how local concentration changes affect condensate nucleation and growth

    • Analysis of downstream effects of induced condensate formation at specific cellular locations

These advanced imaging approaches, particularly when combined with genetic manipulations and biochemical analyses, have the potential to transform our understanding of how ERC1 condensates form, function, and contribute to cellular processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.