Recombinant Saccharomyces cerevisiae Ferric/cupric reductase transmembrane component 1 (FRE1)

Shipped with Ice Packs
In Stock

Description

Gene Structure and Protein Sequence

FRE1 encodes a critical component of the yeast's high-affinity iron uptake system. The deduced amino acid sequence of the FRE1 protein reveals multiple hydrophobic regions compatible with transmembrane domains, suggesting its localization within the plasma membrane . Sequence analysis has revealed significant similarity between FRE1 and the human phagocyte oxidoreductase component, plasma membrane cytochrome b558 (the X-CGD protein), indicating evolutionary conservation of this metalloreductase function . This homology strongly supports the hypothesis that FRE1 functions as a structural component of the yeast ferric reductase complex rather than merely serving as a regulatory element.

The FRE1 gene contains distinctive regulatory elements in its promoter region. Specifically, a segment of 85 base pairs within the FRE1 5' noncoding sequence contains a RAP1 binding site and a repeated sequence with the consensus TTTTTGCTCAYC . This sequence element has proven sufficient to confer iron-repressible transcriptional activity when fused to heterologous downstream promoter elements, demonstrating its central role in the metal-responsive regulation of FRE1 expression.

Relationship to Other FRE Family Members

FRE1 belongs to a larger family of metalloreductase proteins in S. cerevisiae that includes FRE2 and five additional homologs (FRE3-FRE7). These homologs exhibit marked sequence similarity to both FRE1 and FRE2, suggesting they form part of a related protein family with potentially overlapping functions . While FRE1 and FRE2 account for the total plasma membrane-associated reductase activity necessary for iron uptake, the remaining homologs appear to have more specialized roles within yeast metal homeostasis systems.

Iron Reduction and Uptake Mechanism

The principal iron uptake system in S. cerevisiae relies on a reductase activity that acts on ferric iron chelates external to the cell, with FRE1 serving as an essential component of this process . By reducing Fe(III) to Fe(II), FRE1 enables the subsequent uptake of iron through metal-specific permeases. This reduction step is critical because while Fe(III) is the predominant form of iron in aerobic environments, Fe(II) is the substrate for the high-affinity iron transport system of yeast.

Experimental evidence confirms that FRE1 gene product is absolutely required for this reductase activity, as demonstrated by studies using FRE1 mutants . The functional significance of FRE1 in iron metabolism is further highlighted by the observation that FRE1 mRNA levels are tightly regulated by iron availability, with expression being repressed under iron-replete conditions .

Dual Role as Cupric Reductase

Beyond its well-established role in iron metabolism, FRE1 also functions as a cupric reductase, facilitating copper uptake by reducing Cu(II) to Cu(I) . This dual functionality positions FRE1 as a versatile metalloreductase at the interface of both iron and copper homeostasis systems in yeast. While both FRE1 and FRE2 demonstrate cupric reductase activity, only FRE1 activity is induced by copper depletion, even in the presence of iron, revealing sophisticated metal-specific regulation .

The significance of FRE1's cupric reductase activity for copper uptake has been validated through studies monitoring the accumulation of copper-regulated CUP1 and CTR1 mRNAs in fre1Δ, fre2Δ, and fre1Δfre2Δ mutant strains . These experiments confirmed that both Fre1p and Fre2p enzymes are functionally significant for copper uptake, though their regulatory patterns differ substantially.

Iron-Dependent Regulation

FRE1 expression is highly responsive to iron availability, with mRNA levels being repressed under iron-replete conditions and induced during iron limitation . This iron-dependent regulation has been demonstrated through fusion experiments where 977 base pairs of FRE1 DNA upstream from the translation start site were linked to an Escherichia coli lacZ reporter gene, conferring iron-dependent regulation on the expression of β-galactosidase in yeast .

The critical regulatory element within the FRE1 promoter has been narrowed down to an 85-base-pair segment containing a RAP1 binding site and a repeated sequence (TTTTTGCTCAYC). This segment alone is sufficient to confer iron-repressible transcriptional activity on heterologous downstream promoter elements, indicating its central role in iron-responsive gene expression .

Copper-Dependent Regulation

Unlike FRE2, which is primarily iron-regulated, FRE1 demonstrates a sophisticated pattern of copper-responsive regulation . FRE1 expression is induced under conditions of copper limitation, a response that persists even in iron-replete environments. This differential metal-dependent regulation between FRE1 and FRE2 occurs at the transcriptional level.

The transcription factor Mac1p has been identified as the key regulator responsible for both the copper-dependent induction of FRE1 and the down-regulation of FRE2 . Notably, Mac1p's transcriptional activation function is itself modulated by copper availability, creating a multi-layered regulatory network that fine-tunes FRE1 expression according to cellular metal status.

Comparison of Regulatory Mechanisms

The regulatory patterns of FRE family genes reveal distinct metal-dependent control mechanisms, as summarized in Table 1:

Table 1: Metal-Dependent Regulation of FRE Family Genes in S. cerevisiae

GeneIron RegulationCopper RegulationKey Transcription Factors
FRE1Repressed by ironInduced by copper limitationMac1p, RAP1
FRE2Repressed by ironDown-regulated by copper limitationAft1
FRE3-FRE6Specifically iron-regulatedNot significantly copper-regulatedAft1
FRE7Not significantly iron-regulatedSpecifically copper-metalloregulatedMac1p

This differentiated regulation allows S. cerevisiae to orchestrate a precise response to varying metal ion availability in the environment, maintaining optimal levels of essential metals while avoiding toxicity.

Expression Strategies and Challenges

Developing effective expression systems for recombinant FRE1 presents several challenges, particularly regarding protein folding, post-translational modifications, and functional membrane integration. While the search results do not provide specific information about recombinant FRE1 expression systems, general approaches for expressing transmembrane proteins in S. cerevisiae can be adapted for FRE1 production.

In S. cerevisiae expression systems, the cellular trafficking pathways responsible for appropriate membrane targeting must be considered. Similar to other recombinant transmembrane proteins in yeast, FRE1 likely requires specific secretion signals and processing events for functional expression . The TFP (Tandem Fluorescent Protein) system, which has been successfully applied to other secreted enzymes in S. cerevisiae, represents a potential approach for optimizing FRE1 expression .

Post-Translational Modifications

As with many yeast membrane proteins, recombinant FRE1 likely undergoes significant post-translational modifications, including glycosylation. Over-glycosylation can potentially affect protein function, as observed with other recombinant proteins expressed in S. cerevisiae . The proper folding and integration of FRE1 into the plasma membrane are critical for maintaining its reductase activity and ensuring appropriate metal ion processing.

Biotechnological Potential

Recombinant FRE1 holds potential value for various biotechnological applications, particularly in processes requiring controlled metal reduction or uptake. While direct applications of recombinant FRE1 are not extensively documented in the search results, its metal reduction capabilities could potentially be harnessed for bioremediation of metal-contaminated environments or bioprocessing applications requiring controlled metal reduction.

The ability to manipulate FRE1 expression and activity through recombinant approaches offers opportunities to engineer yeast strains with enhanced metal uptake capabilities or altered metal preferences. Such engineered strains could potentially serve as valuable tools for metal recovery from dilute solutions or for developing metal-specific biosensors.

Research Applications

From a research perspective, recombinant FRE1 serves as an important model system for studying eukaryotic membrane-bound metalloreductases. The detailed characterization of FRE1 structure, function, and regulation provides insights into fundamental mechanisms of metal homeostasis, which can inform broader understanding of metal trafficking in eukaryotic cells, including humans.

The homology between FRE1 and human cytochrome b558 suggests potential relevance to understanding human disorders associated with metal metabolism, such as hereditary hemochromatosis or Wilson's disease . Recombinant FRE1 could potentially serve as a model system for investigating metal-related human diseases or for screening compounds that modulate metalloreductase activity.

FRE Family Proteins

The S. cerevisiae genome contains a family of FRE-like proteins with varying functions and regulatory patterns. While FRE1 and FRE2 account for the majority of plasma membrane-associated ferric reductase activity, the additional homologs (FRE3-FRE7) appear to have more specialized roles . These homologs are expressed genes in S. cerevisiae, and their expression is metalloregulated similar to FRE1 and FRE2, though with distinct patterns of responsiveness to iron and copper availability.

Four of the homologs (FRE3-FRE6) are specifically iron-regulated through the Aft1 transcription factor, with expression elevated in AFT1-1 cells and attenuated in aft1 null cells . In contrast, FRE7 is specifically copper-metalloregulated, with expression patterns consistent with Mac1 being the critical transcriptional activator . The 5' promoter sequence of FRE7 contains three copper-responsive promoter elements, with two elements being critical for Mac1-dependent expression.

Evolutionary Conservation of Metalloreductases

The significant sequence similarity between FRE1 and human cytochrome b558 suggests evolutionary conservation of metalloreductase functions across diverse eukaryotic species . This conservation underscores the fundamental importance of controlled metal reduction in biological systems and suggests that insights gained from studying recombinant FRE1 may have broader applicability across species.

Table 2: Comparison of FRE1 with Related Metalloreductases

ProteinOrganismPrimary FunctionMetal SpecificityRegulatory Factors
FRE1S. cerevisiaeFe(III)/Cu(II) reductionFe, CuFe repression, Cu induction via Mac1p
FRE2S. cerevisiaeFe(III)/Cu(II) reductionPrimarily FeFe repression via Aft1
Cytochrome b558HumansSuperoxide generationNADPHMultiple regulatory mechanisms
FRE3-FRE6S. cerevisiaePutative Fe(III) reductionFeFe regulation via Aft1
FRE7S. cerevisiaePutative Cu(II) reductionCuCu regulation via Mac1

This comparative analysis highlights both the shared functional characteristics across metalloreductase systems and their distinctive regulatory mechanisms, reflecting adaptation to specific physiological requirements.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method and location. For precise delivery timelines, please contact your local distributors.
All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during the production process. If you have a preferred tag type, please communicate it to us, and we will prioritize its implementation.
Synonyms
FRE1; YLR214W; L8167.2; Ferric/cupric reductase transmembrane component 1; Ferric-chelate reductase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-686
Protein Length
Full Length of Mature Protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
FRE1
Target Protein Sequence
TLISTSCISQAALYQFGCSSKSKSCYCKNINWLGSVTACAYENSKSNKTLDSALMKLASQ CSSIKVYTLEDMKNIYLNASNYLRAPEKSDKKTVVSQPLMANETAYHYYYEENYGIHLNL MRSQWCAWGLVFFWVAVLTAATILNILKRVFGKNIMANSVKKSLIYPSVYKDYNERTFYL WKRLPFNFTTRGKGLVVLIFVILTILSLSFGHNIKLPHPYDRPRWRRSMAFVSRRADLMA IALFPVVYLFGIRNNPFIPITGLSFSTFNFYHKWSAYVCFMLAVVHSIVMTASGVKRGVF QSLVRKFYFRWGIVATILMSIIIFQSEKVFRNRGYEIFLLIHKAMNIMFIIAMYYHCHTL GWMGWIWSMAGILCFDRFCRIVRIIMNGGLKTATLSTTDDSNVIKISVKKPKFFKYQVGA FAYMYFLSPKSAWFYSFQSHPFTVLSERHRDPNNPDQLTMYVKANKGITRVLLSKVLSAP NHTVDCKIFLEGPYGVTVPHIAKLKRNLVGVAAGLGVAAIYPHFVECLRLPSTDQLQHKF YWIVNDLSHLKWFENELQWLKEKSCEVSVIYTGSSVEDTNSDESTKGFDDKEESEITVEC LNKRPDLKELVRSEIKLSELENNNITFYSCGPATFNDDFRNAVVQGIDSSLKIDVELEEE SFTW
Uniprot No.

Target Background

Function
Ferric/cupric reductase transmembrane component 1 (FRE1) is a metalloreductase responsible for reducing extracellular iron and copper before their import. It catalyzes the reductive uptake of Fe(3+)-salts and Fe(3+) bound to catecholate or hydroxamate siderophores. Fe(3+) is reduced to Fe(2+), which then dissociates from the siderophore and can be transported by the high-affinity Fe(2+) transport complex located in the plasma membrane. FRE1 also plays a role in Cu(2+) reduction and Cu(+) uptake.
Gene References Into Functions
  1. Inhibition of Fre1 by nitric oxide was also observed to inhibit yeast growth in low-iron medium. PMID: 15288128
Database Links

KEGG: sce:YLR214W

STRING: 4932.YLR214W

Protein Families
Ferric reductase (FRE) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of FRE1?

FRE1 is a transmembrane protein functioning as a ferric/cupric reductase in Saccharomyces cerevisiae (baker's yeast). The mature protein spans amino acids 23-686 of the full sequence and contains multiple transmembrane domains that facilitate its role in metal ion reduction at the cell surface . FRE1 plays a critical role in iron and copper homeostasis by reducing Fe(III) and Cu(II) to their more bioavailable Fe(II) and Cu(I) forms, respectively.

The protein contains characteristic sequence motifs including cysteine-rich regions (visible in the N-terminal portion: TLISTSCISQAALYQFGCSSKSKSCYCKNIN...) that are often associated with metal binding or redox activity . The transmembrane topology is essential for its functional mechanism, allowing electron transfer across the membrane to reduce extracellular metal ions.

For studying FRE1's structure-function relationship, researchers should consider that recombinant versions typically include tags (such as His-tags) that may influence certain biophysical assays but generally preserve catalytic functionality .

How should recombinant FRE1 be stored to maintain optimal activity for experiments?

Proper storage of recombinant FRE1 is critical for maintaining its structural integrity and enzymatic activity. The protein should be stored at -20°C to -80°C for extended storage periods . For working solutions, storage at 4°C is recommended, but only for up to one week to prevent activity loss .

When handling recombinant FRE1, researchers should avoid repeated freeze-thaw cycles as these can significantly decrease protein activity and structural integrity . A methodological approach to minimize freeze-thaw damage includes:

  • Aliquoting the protein solution immediately after reconstitution

  • Adding glycerol to a final concentration of 5-50% (with 50% being optimal for many applications)

  • Using deionized sterile water for reconstitution to a concentration of 0.1-1.0 mg/mL

The storage buffer composition (Tris/PBS-based buffer with 6% Trehalose, pH 8.0) has been optimized to maintain stability during freeze-thaw transitions . This buffer system helps prevent protein aggregation and maintains the native conformation of the transmembrane regions.

What expression systems are most effective for producing functional recombinant FRE1?

The most commonly used and effective expression system for recombinant FRE1 production is Escherichia coli . Despite FRE1 being a eukaryotic transmembrane protein, E. coli expression systems have been successfully employed to produce functional protein when proper folding conditions are established.

For methodological considerations, researchers should note that recombinant FRE1 is typically expressed as the mature protein (amino acids 23-686) rather than the full-length sequence including the signal peptide . This approach improves expression efficiency and proper folding in heterologous systems.

The addition of a histidine tag (either N-terminal His-tag or 10xHis-tagged constructs) facilitates purification using immobilized metal affinity chromatography (IMAC) while generally preserving the functional properties of the protein . When designing expression constructs, researchers should consider that the tag location may affect membrane insertion and topology, with N-terminal tags generally being preferred for this particular protein.

How should researchers design experiments to assess FRE1 reductase activity in vitro?

When designing experiments to assess FRE1 reductase activity, researchers must carefully consider several methodological aspects to ensure reliable and reproducible results. A systematic experimental approach should follow these principles:

  • Define the independent variable (substrate concentration, pH, temperature) and dependent variable (reductase activity measured as Fe(III) or Cu(II) reduction)

  • Establish appropriate controls, including heat-inactivated enzyme and no-enzyme controls

  • Account for potential confounding variables such as spontaneous reduction and metal ion contamination

A typical assay methodology involves:

  • Reconstituting the lyophilized protein in an appropriate buffer system

  • Creating a reaction mixture containing the metal substrate (Fe(III) or Cu(II) complexes)

  • Adding an appropriate electron donor system

  • Measuring reduction rates through spectrophotometric methods or colorimetric indicators

What are the key variables to control when using recombinant FRE1 in reduction assays?

When conducting reduction assays with recombinant FRE1, researchers must control several key variables to ensure experimental validity and reproducibility. These variables can be categorized as follows:

Variable CategorySpecific FactorsMethodological Control
Protein-relatedConcentration, purity, tag influenceUse consistent protein concentration (0.1-1.0 mg/mL); verify purity via SDS-PAGE (>90%)
Buffer conditionspH, ionic strength, presence of detergentsMaintain consistent buffer composition (Tris/PBS-based) and pH (8.0)
Substrate-relatedMetal species, concentration, complexation stateUse defined metal complexes at consistent concentrations
EnvironmentalTemperature, oxygen exposure, light sensitivityControl reaction temperature; consider anaerobic conditions for oxygen-sensitive assays

Researchers should apply a systematic approach to variable manipulation, changing only one independent variable at a time while maintaining others constant . This allows for clear establishment of cause-effect relationships between experimental conditions and FRE1 activity.

For advanced studies, consider within-subject or between-subject experimental designs depending on whether you're examining the effect of multiple conditions on the same protein preparation or comparing different protein variants under identical conditions .

How can researchers effectively reconstitute lyophilized FRE1 for functional studies?

Effective reconstitution of lyophilized FRE1 is critical for maintaining protein functionality in subsequent experiments. A methodological approach to reconstitution should include:

  • Brief centrifugation of the vial prior to opening to ensure all protein content settles at the bottom

  • Reconstitution using deionized sterile water to a final concentration of 0.1-1.0 mg/mL

  • Gentle mixing by inversion rather than vortexing to prevent protein denaturation

  • Addition of glycerol to a final concentration of 5-50% for storage stability

  • Immediate aliquoting to prevent repeated freeze-thaw cycles

For membrane proteins like FRE1, consideration should be given to the potential need for detergents or lipid environments to maintain proper folding and functionality. While the product information doesn't explicitly mention detergent requirements, researchers studying transmembrane protein function should evaluate whether addition of mild non-ionic detergents might improve protein stability or activity in their specific experimental system.

The reconstitution process should be validated by assessing protein activity immediately after reconstitution to establish a baseline for subsequent storage condition comparisons and experimental planning.

What approaches can be used to study the metal specificity of FRE1 in different experimental contexts?

Studying the metal specificity of FRE1 requires sophisticated experimental approaches that can distinguish between different metal reduction activities. Researchers can employ several methodological strategies:

  • Comparative kinetic analysis using various metal substrates (Fe(III), Cu(II), and other transition metals)

  • Competition assays with mixed metal substrates to determine preferential reduction

  • Site-directed mutagenesis of potential metal-binding residues, particularly focusing on the cysteine-rich regions (TLISTSCISQAALYQFGCSSKSKSCYCKNIN) in the N-terminal domain

  • Spectroscopic approaches (EPR, X-ray absorption) to directly observe metal binding and reduction events

When designing these experiments, researchers should consider:

  • The specific hypothesis being tested about metal selectivity

  • Appropriate controls to account for spontaneous reduction of metal ions

  • The potential influence of the His-tag on metal binding properties

  • The need for anaerobic conditions to prevent re-oxidation of reduced metal species

Analysis of the protein sequence reveals multiple potential metal-binding motifs, particularly in the cysteine-rich regions, which may participate differently in the reduction of various metal ions . Advanced researchers can correlate functional data with structural predictions to develop mechanistic models of FRE1's metal discrimination properties.

How can researchers investigate the membrane topology and integration of FRE1?

Investigating the membrane topology and integration of FRE1 requires specialized techniques designed for transmembrane proteins. A comprehensive methodological approach includes:

  • Protease accessibility assays to determine exposed versus protected regions of the protein

  • Fluorescence-based techniques using site-specific labeling of cysteine residues

  • Epitope insertion studies combined with immunofluorescence microscopy

  • Computational prediction tools validated with experimental data

The full amino acid sequence of FRE1 (amino acids 23-686) contains multiple hydrophobic regions that likely form transmembrane domains . These domains are essential for the protein's function in reducing extracellular metal ions while utilizing intracellular electron donors.

For experimental work, researchers should consider:

  • The influence of the His-tag on membrane insertion and topology

  • The possible need for yeast-specific lipids to achieve native conformation

  • Differences between recombinant systems (E. coli) and the native yeast environment

A thorough topological analysis would map the orientation of each transmembrane segment and identify regions exposed to either side of the membrane, providing insights into the electron transfer pathway involved in metal reduction.

What techniques can be employed to study FRE1 interactions with other components of yeast iron and copper homeostasis systems?

Studying FRE1's interactions with other components of yeast metal homeostasis systems requires integrative approaches combining molecular, biochemical, and cellular techniques. Advanced researchers should consider these methodological strategies:

  • Co-immunoprecipitation studies using the His-tagged FRE1 as bait to identify interaction partners

  • Yeast two-hybrid or split-ubiquitin assays optimized for membrane protein interactions

  • Proximity labeling approaches (BioID, APEX) to identify neighboring proteins in the cellular context

  • Genetic interaction studies using synthetic lethality/sickness screens

When designing interaction studies, researchers should:

  • Consider both stable and transient interactions

  • Account for the transmembrane nature of FRE1 when selecting appropriate techniques

  • Validate interactions using multiple independent methods

  • Correlate interaction data with functional outcomes in metal homeostasis

Analysis of the FRE1 sequence (TLISTSCISQAALYQFGCSSKSKSCYCKNIN...) reveals potential interaction motifs, particularly in the N-terminal and C-terminal regions that likely extend into the cytoplasm or extracellular space . These regions may mediate interactions with other components of the iron and copper uptake systems in yeast.

What are common challenges in working with recombinant FRE1 and how can they be addressed?

Working with recombinant FRE1 presents several technical challenges due to its nature as a transmembrane protein. Researchers commonly encounter these issues:

  • Protein aggregation during storage or thawing:

    • Methodological solution: Add glycerol (5-50%) to storage buffer and aliquot into single-use volumes

    • Avoid repeated freeze-thaw cycles and store working aliquots at 4°C for up to one week

  • Loss of activity during reconstitution:

    • Methodological solution: Reconstitute in appropriate buffer (Tris/PBS-based, pH 8.0) with 6% Trehalose

    • Consider adding mild non-ionic detergents if forming micelles or proteoliposomes

  • Difficulty measuring activity in vitro:

    • Methodological solution: Optimize electron donor systems and metal substrate complexes

    • Consider anaerobic conditions to prevent re-oxidation of reduced metal species

  • Variability between protein preparations:

    • Methodological solution: Implement rigorous quality control testing including SDS-PAGE analysis (>90% purity)

    • Develop quantitative activity assays to normalize across preparations

Researchers should document troubleshooting steps systematically, testing one variable at a time while maintaining others constant to identify optimal conditions for their specific experimental application .

How can researchers validate that recombinant FRE1 retains native conformation and activity?

  • Functional assays:

    • Measure ferric and cupric reductase activities using established spectrophotometric methods

    • Compare kinetic parameters (Km, Vmax) with literature values for native FRE1

  • Structural validation:

    • Circular dichroism (CD) spectroscopy to assess secondary structure content

    • Limited proteolysis to examine domain folding and accessibility

    • Thermal stability assays to determine melting temperature

  • Comparative analysis:

    • Side-by-side testing with native FRE1 (if available)

    • Complementation studies in fre1 deletion yeast strains

  • Activity controls:

    • Include positive controls (known active preparations) and negative controls (heat-inactivated enzyme)

    • Test responsiveness to known inhibitors or activators

For recombinant FRE1 expressed in E. coli, researchers should be particularly attentive to proper folding of the transmembrane domains, which may require specialized expression conditions or post-expression processing . The His-tag, while useful for purification, should be evaluated for its potential impact on protein function through comparative studies with untagged or differently tagged versions when possible .

What analytical methods are most appropriate for assessing FRE1 purity and structural integrity?

A comprehensive analytical approach to assessing FRE1 purity and structural integrity should combine multiple complementary techniques. Researchers should implement:

  • Purity assessment:

    • SDS-PAGE with Coomassie or silver staining (should show >90% purity)

    • Size exclusion chromatography to detect aggregates and oligomeric states

    • Western blotting using anti-His antibodies for tagged protein detection

  • Structural integrity analysis:

    • Mass spectrometry to confirm protein identity and detect post-translational modifications

    • Circular dichroism spectroscopy to evaluate secondary structure composition

    • Fluorescence spectroscopy to assess tertiary structure through intrinsic tryptophan fluorescence

  • Functional correlates:

    • Activity assays as indicators of proper folding

    • Ligand binding assays using known substrates or inhibitors

    • Thermal shift assays to evaluate stability under various conditions

When interpreting analytical data, researchers should consider that transmembrane proteins like FRE1 may exhibit atypical behavior in certain assays due to their hydrophobic nature. For example, apparent molecular weight on SDS-PAGE may differ from calculated values, and standard protein quantification methods may require calibration specific to membrane proteins.

The multi-method approach provides a more complete picture of protein quality than any single technique and helps researchers establish quality control benchmarks for consistent experimental performance.

How might structural studies of FRE1 advance understanding of its catalytic mechanism?

Advanced structural studies of FRE1 would significantly enhance our understanding of its catalytic mechanism and metal specificity. Future research directions should consider:

  • Cryo-electron microscopy approaches:

    • Determination of high-resolution structures in different conformational states

    • Visualization of metal binding sites and electron transfer pathways

    • Mapping of transmembrane topology in a lipid environment

  • Computational modeling and simulation:

    • Molecular dynamics simulations to understand conformational dynamics

    • Quantum mechanical calculations of the electron transfer process

    • Docking studies with different metal substrates to explain specificity

  • Structure-guided mutagenesis:

    • Systematic alteration of potential metal-coordinating residues

    • Modification of transmembrane domains to understand membrane integration

    • Engineering of variants with altered metal specificity

The complete amino acid sequence of FRE1 (TLISTSCISQAALYQFGCSSKSKSCYCKNIN...) contains numerous conserved motifs that likely play crucial roles in catalysis. Detailed structural information would allow researchers to connect sequence features with specific functional roles and potentially design improved variants for biotechnological applications.

What methodological advances would help better understand FRE1's role in cellular metal homeostasis?

Understanding FRE1's role in cellular metal homeostasis requires innovative methodological approaches that bridge molecular mechanisms with cellular physiology. Future methodological directions include:

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize FRE1 distribution and dynamics

    • Correlative light and electron microscopy to connect function with ultrastructure

    • Live-cell metal sensors to monitor reduction activity in real-time

  • Systems biology approaches:

    • Multi-omics integration (transcriptomics, proteomics, metallomics)

    • Network analysis of metal homeostasis pathways

    • Mathematical modeling of metal reduction and transport dynamics

  • Genetic engineering advances:

    • CRISPR-Cas9 modification of endogenous FRE1

    • Optogenetic control of FRE1 expression or activity

    • Synthetic biology approaches to reconstitute metal homeostasis systems

  • Translational approaches:

    • Development of FRE1-based biosensors for environmental metal detection

    • Exploration of FRE1 homologs in pathogenic fungi as potential drug targets

These methodological advances would help researchers move beyond in vitro characterization of recombinant FRE1 to understand its dynamic behavior in living cells and its coordination with other components of metal homeostasis systems.

How can recombinant FRE1 be utilized to develop novel biotechnological applications?

Recombinant FRE1 presents numerous opportunities for biotechnological innovation based on its metal reduction capabilities. Researchers exploring these applications should consider:

  • Environmental remediation technologies:

    • Immobilized FRE1 systems for heavy metal bioremediation

    • Engineered microorganisms with enhanced FRE1 expression for contaminated soil treatment

    • Coupled enzyme systems for complete metal transformation processes

  • Biosensor development:

    • FRE1-based electrochemical sensors for metal ion detection

    • Whole-cell biosensors using FRE1 promoter-reporter fusions

    • Point-of-use devices for water quality monitoring

  • Biomaterials production:

    • Controlled metal nanoparticle synthesis through enzymatic reduction

    • Creation of novel metal-protein hybrid materials

    • Surface functionalization using immobilized FRE1

  • Industrial biotechnology:

    • Enhanced microbial fermentation through improved metal bioavailability

    • Bioprocessing applications requiring controlled redox environments

    • Enzymatic alternatives to chemical reducing agents

When developing these applications, researchers should leverage the detailed molecular understanding of recombinant FRE1, including its expression and reconstitution protocols , while considering how protein engineering might enhance stability, activity, or specificity for specific biotechnological contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.