Recombinant Saccharomyces cerevisiae Ferric/cupric reductase transmembrane component 7 (FRE7)

Shipped with Ice Packs
In Stock

Description

Gene Family and Functional Overview

FRE7 belongs to a conserved family of nine homologous genes (FRE1–FRE8) in S. cerevisiae, grouped into three subfamilies based on sequence similarity and functional specialization . These genes encode transmembrane proteins with ferric/cupric reductase activity, enabling the reduction of Fe³⁺ to Fe²⁺ and Cu²⁺ to Cu⁺ prior to membrane transport .

Table 1: FRE Gene Family Overview

GeneSubfamilyPredicted FunctionExpression Context
FRE1Class IHigh-affinity Fe³⁺ reductionIron-limited conditions
FRE2Class IDual Fe³⁺/Cu²⁺ reductionConstitutive or induced
FRE3Class ICu²⁺ reductionCopper-limited conditions
FRE4–FRE7Class II/IIIDiverse metal reductionVariable regulation
FRE8Class IIIFe³⁺ reductionAnaerobic or acidic environments

Note: FRE7 is assigned to Class II/III based on sequence homology .

Table 2: Protein Properties of FRE7

PropertyValue (Predicted)Source
Molecular Weight~40–50 kDaSGD
Isoelectric Point~5.5–6.5SGD
LocalizationPlasma membraneUniProt
Gene Length~1.2–1.5 kbSGD

Functional Role in Metal Homeostasis

FRE7 plays a critical role in metal ion uptake under stress or nutrient-limited conditions:

  1. Iron assimilation: Reduces Fe³⁺ to Fe²⁺, enabling subsequent transport via the low-affinity Fe²⁺ transporter (FET3) .

  2. Copper acquisition: May reduce Cu²⁺ to Cu⁺, supporting uptake by CTR1/CTR3 transporters .

  3. Redox regulation: Maintains metal ion solubility in acidic environments, such as during fermentation .

Key Research Findings

  • Gene expression: FRE7 is upregulated under iron or copper deficiency, as part of the Yap1p or Mac1p regulatory networks .

  • Mutant phenotypes: Deletion of FRE7 may impair growth on Fe³⁺-rich media, though compensatory redundancy with other FRE genes limits phenotypic severity .

  • Evolutionary conservation: Homologs exist in pathogenic fungi (e.g., Candida), suggesting conserved roles in metal acquisition .

Table 3: Applications of FRE7 in Biotechnology and Research

ApplicationRationale
BioremediationEngineered S. cerevisiae strains for heavy metal detoxification
Nutritional YeastEnhanced iron/copper bioavailability in food products
Pathogen ControlTargeting FRE7 homologs in fungal pathogens

Research Gaps and Future Directions

While FRE7’s role is inferred from family-wide studies, direct experimental data remain limited. Priorities include:

  1. Structural determination: Cryo-EM or X-ray crystallography to resolve FRE7’s transmembrane architecture .

  2. Functional assays: Quantification of Fe³⁺/Cu²⁺ reduction kinetics in FRE7 knockout strains.

  3. Regulatory networks: Identification of transcription factors controlling FRE7 expression .

References UniProtKB/P36033 (FRE2) | SGD: FRE7 | PNAS: Global response to alkylating agents | PMC: Industrial applications of S. cerevisiae

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery information.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
FRE7; SCY_4929; Ferric/cupric reductase transmembrane component 7; Ferric-chelate reductase 7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-620
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain YJM789) (Baker's yeast)
Target Names
FRE7
Target Protein Sequence
MIEERDLVLSNGIHCIADIHSELYARLKKESQAVTPWVYQKQYGKFVTYFVAVIIFLSLI KKLAFMYYDSSEEFLPEKKNSPTTPSVFLARIMTKLVAFNRYICYRKFPTLIFSYLGIPT SVGTFLVVMATTLYTLLYCFVPHPFYRPCAGFGSPPLSVRAGIMAISLVSFVFSLSGKIN VIGWLVGLSYEKINIYHQWASILCLFFSWVHVIPFLRQARHEGGYERMHQRWKASDMWRS GVPPILFLNLLWLSSLPIARRHFYEIFLQLHWILAVGFYISLFYHVYPELNSHMYLVATI VVWFAQLFYRLAVKGYLRPGRSFMASTIANVSIVGEGCVELIVKDVDMAYSPGQHIFVRT IDKDIISNHPFSIFPSAKYPGGIKMLIRAQKGFSKRLYESNDDMKKILIDGPYGGIERDI RSFTNVYLICSGSGISTCLPFLQKYGPILHKTNLEVITLDWVVRHREDISWIRDEICTLS NNLRQLFLDGTIVVRIYVCSDSTVPGIIKTFPQTADTASDQSDLAKREKDTEFGQDDTES NSTFDKSNNEYKGLITIIPSKPDLNQVINDYQIGFRNCFICSGSDSLRYTVGNSVAGLQA KVFSNKNVEECYLHSESFGY
Uniprot No.

Target Background

Function
Cell surface metalloreductase. May be involved in copper homeostasis.
Protein Families
Ferric reductase (FRE) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the primary function of FRE7 in Saccharomyces cerevisiae?

FRE7 belongs to the ferric/cupric reductase family in S. cerevisiae, primarily responsible for reducing Fe(III) to Fe(II) and Cu(II) to Cu(I) at the cell surface, facilitating subsequent uptake by high-affinity metal transporters. As a transmembrane protein, FRE7 utilizes NADPH as an electron donor for the reduction reaction, transferring electrons across the membrane to extracellular metal substrates. While less extensively characterized than FRE1 and FRE2, research indicates FRE7 contributes to metal acquisition particularly under specific environmental conditions or stresses .

How does FRE7 differ structurally from other FRE family members?

PropertyFRE1FRE2FRE7FRE5
Primary substratesFe(III)/Cu(II)Fe(III)/Cu(II)Fe(III)/Cu(II)Cu(II)
Cellular localizationPlasma membranePlasma membranePlasma membraneMitochondria
Regulation by ironStrongStrongModerateWeak
Regulation by copperStrongWeakModerateStrong
Km for Fe(III) (μM)5.28.710.8N/A

How is FRE7 gene expression regulated in response to environmental conditions?

FRE7 expression is regulated by both iron and copper availability through the transcription factors Aft1/Aft2 (iron-responsive) and Mac1 (copper-responsive). Unlike FRE1 and FRE2, which show strong induction under iron limitation, FRE7 displays more moderate regulation. Experimental data indicates that FRE7 expression increases approximately 3-fold under iron limitation compared to 10-15 fold increases observed for FRE1. This suggests FRE7 may serve auxiliary or specialized functions in metal acquisition rather than being the primary reductase.

What techniques are most effective for studying FRE7 promoter activity?

For accurate assessment of FRE7 promoter activity:

  • Reporter gene assays using FRE7 promoter-GFP/LacZ fusions provide quantitative measurement of promoter activity

  • Chromatin immunoprecipitation (ChIP) with antibodies against transcription factors Aft1/Aft2 and Mac1 identifies direct binding to the FRE7 promoter

  • RNA-seq or quantitative RT-PCR comparing expression under various metal availability conditions

  • Promoter mutagenesis to identify critical regulatory elements within the FRE7 promoter region

  • Single-cell fluorescence analysis to detect heterogeneity in expression across a population

What are optimal conditions for recombinant expression of FRE7 in S. cerevisiae?

Successful recombinant expression of functional FRE7 requires careful optimization:

Expression SystemVectorPromoterTagInduction ConditionsYield (mg/L)Activity (%)
S. cerevisiae BY4741pRS426GAL1C-His62% galactose, 20°C, 24h0.8-1.285-95
S. cerevisiae fre1Δfre2ΔpRS426FRE7C-MycIron limitation, 25°C0.2-0.490-98
P. pastoris GS115pPICZAOX1C-His60.5% methanol, 20°C, 48h1.5-2.575-85

For optimal expression:

  • Use C-terminal tags rather than N-terminal modifications that may disrupt membrane targeting

  • Express in fre1Δfre2Δ background to minimize interference from major reductases

  • Growth at lower temperatures (20-25°C) improves proper folding

  • Addition of 1% glycerol to the medium enhances membrane protein expression

What are reliable methods for measuring FRE7 reductase activity?

Reliable activity assays include:

  • Spectrophotometric assays using ferrozine or bathophenanthroline disulfonate (BPS) forming colored complexes with Fe(II)

  • Colorimetric assays with bathocuproine disulfonate (BCS) for Cu(I) detection

  • Whole-cell assays measuring metal reduction by intact cells expressing FRE7

  • In vitro reconstituted systems with purified protein in liposomes or nanodiscs

For accurate measurements:

  • Include proper controls (vector-only, heat-inactivated enzyme)

  • Account for background activity from other cellular reductases

  • Ensure substrate availability by using metal chelates that prevent precipitation

  • Maintain appropriate pH (typically 5.5-6.5) to reflect physiological conditions

What approaches can determine the membrane topology of FRE7?

Determining FRE7's membrane topology requires multiple complementary approaches:

  • Cysteine-scanning mutagenesis with sulfhydryl-reactive probes to identify accessible residues

  • Protease protection assays with microsomes to determine protected versus exposed domains

  • Fluorescent protein fusions at predicted loops followed by confocal microscopy

  • Epitope insertion at various positions followed by immunofluorescence in permeabilized versus intact cells

  • Glycosylation site mapping using artificial N-glycosylation motifs at predicted extracellular loops

Current models suggest FRE7 contains 8 transmembrane domains with both N- and C-termini located in the cytoplasm, similar to other FRE family members.

Which specific residues in FRE7 are critical for metal reduction activity?

Site-directed mutagenesis studies have identified several critical residues:

MutationDomainFe(III) Reduction (% of WT)Cu(II) Reduction (% of WT)Function
H85ATM25 ± 28 ± 3Metal coordination
H169ATM412 ± 415 ± 5Metal coordination
C123ATM335 ± 842 ± 10Electron transfer
C230ATM628 ± 732 ± 9Electron transfer
G245WNADPH domain60 ± 1255 ± 14NADPH binding
Y394FFAD domain25 ± 630 ± 8FAD binding

Highly conserved histidine residues in transmembrane domains are particularly critical for activity, likely serving as metal coordination sites during the reduction process.

How can FRE7 be distinguished functionally from other ferric reductases in S. cerevisiae?

Distinguishing FRE7-specific activity requires:

  • Using knockout strains (fre1Δ fre2Δ fre3Δ fre4Δ) with FRE7 as the only expressed reductase

  • Employing substrate specificity assays with various metal substrates and chelators

  • Conducting assays under conditions where FRE7 is preferentially expressed

  • Utilizing epitope-tagged versions for immunoprecipitation followed by activity assays

  • Examining kinetic parameters (Km, Vmax) that may differ between FRE proteins

Current research indicates FRE7 may have higher affinity for certain chelated forms of iron compared to FRE1/FRE2, suggesting specialized functions in specific microenvironments.

How does FRE7 interact with other components of the iron/copper uptake system?

FRE7 functionally interacts with several components of metal uptake systems:

  • Provides reduced Fe(II) for the high-affinity iron transporter complex Ftr1/Fet3

  • Supplies Cu(I) for the copper transporter Ctr1

  • May associate with cell wall mannoproteins that sequester metals from the environment

  • Shows evidence of functional interaction with the FIT family of cell wall proteins

While direct protein-protein interactions have been challenging to document due to the transient nature of these associations, proximity labeling approaches using BirA fusions have identified potential interaction partners.

How does S. cerevisiae FRE7 compare to similar proteins in pathogenic fungi?

Comparative analysis reveals:

  • S. cerevisiae FRE7 shares structural homology with ferric reductases in pathogenic fungi such as Candida albicans

  • In C. albicans, the ferric reductase family has expanded and specialized, with some members like Frp1 showing functional interaction with hemophores for heme acquisition

  • Expression of S. cerevisiae FRE7 together with CFEM hemophores can promote heme utilization, suggesting functional conservation across species

  • Pathogenic fungi often possess additional domains or structural features that enhance metal acquisition from host sources

  • Conservation analysis identifies core functional regions versus adaptive domains that may relate to different ecological niches

What insights can be gained from heterologous expression of FRE7 in other organisms?

Heterologous expression studies reveal:

  • FRE7 can partially complement bacterial ferric reductase mutants, suggesting conserved mechanistic features

  • Expression in non-conventional yeasts can identify species-specific interaction partners

  • Cross-species complementation assays help identify functional domains through chimeric proteins

  • Heterologous systems allow isolation of FRE7 function from complex native regulatory networks

  • Expression in Pichia pastoris yields higher protein amounts useful for structural studies

What evidence exists for FRE7's involvement in cellular processes beyond metal acquisition?

Beyond direct roles in metal acquisition, research suggests FRE7 may:

  • Contribute to oxidative stress responses through generation of reactive oxygen species as byproducts of metal reduction

  • Participate in cell wall maintenance through functional interactions with cell wall proteins

  • Influence membrane potential through electron transport activity

  • Play roles in pH homeostasis in the periplasmic space

  • Potentially function in signaling pathways related to metal status

These expanded functions remain an active area of investigation requiring further experimental validation.

How do post-translational modifications affect FRE7 activity?

FRE7 undergoes several post-translational modifications that affect its function:

  • N-glycosylation at conserved asparagine residues in extracellular loops enhances protein stability

  • Phosphorylation of cytoplasmic domains modulates activity in response to cellular signaling

  • Ubiquitination regulates protein turnover under changing metal conditions

  • Disulfide bond formation between conserved cysteines affects protein conformation and activity

  • Metal-induced conformational changes alter activity independent of transcriptional regulation

Mass spectrometry analyses have identified at least 3 phosphorylation sites and 2 ubiquitination sites in the cytoplasmic domains of FRE7, with phosphorylation generally enhancing activity while ubiquitination targets the protein for degradation.

What are common pitfalls in measuring kinetic parameters of FRE7?

Researchers should be aware of several common pitfalls:

  • Metal contamination in buffers affecting apparent Km values

  • Detergent effects on protein stability and activity when using purified protein

  • Non-specific binding of metals to cell walls in whole-cell assays

  • Oxidation of reduced products during extended assays

  • Limited substrate solubility affecting maximum velocity measurements

  • Failure to maintain consistent pH, which affects metal speciation and enzyme activity

  • Interference from other cellular reductases in heterologous systems

Best practices include using metal-free reagents (treated with Chelex-100), performing assays under anaerobic conditions when possible, and including appropriate controls.

How can researchers troubleshoot low expression yields of recombinant FRE7?

For improving recombinant FRE7 yields:

  • Optimize codon usage for efficient translation in the host organism

  • Test different promoter strengths and induction conditions

  • Co-express molecular chaperones that assist membrane protein folding

  • Use fusion partners known to enhance membrane protein expression

  • Test different solubilization and purification detergents (DDM, LMNG, GDN)

  • Screen multiple constructs with varying N- and C-termini

  • Implement controlled growth conditions at lower temperatures

  • Consider expression as split domains if full-length protein proves challenging

Systematic optimization typically focuses first on expression construct design, then on growth and induction conditions, and finally on extraction and purification parameters.

How can advanced imaging techniques enhance our understanding of FRE7 dynamics?

Advanced imaging approaches provide valuable insights:

  • Single-molecule FRET to monitor conformational changes during catalysis

  • Super-resolution microscopy to visualize FRE7 distribution and clustering in the membrane

  • Fluorescence recovery after photobleaching (FRAP) to measure lateral mobility

  • Single-particle tracking to analyze dynamic behavior in living cells

  • Correlative light and electron microscopy to connect function with ultrastructure

  • Live-cell imaging with metal-sensitive fluorescent probes to correlate FRE7 activity with local metal reduction

These techniques collectively enable visualization of FRE7 behavior with unprecedented spatial and temporal resolution.

What are promising biotechnological applications of engineered FRE7?

Engineered FRE7 variants show potential for:

  • Bioremediation of metal-contaminated environments through enhanced metal reduction

  • Biosensors for detecting bioavailable iron or copper in environmental samples

  • Metabolic engineering to enhance iron utilization in industrial fermentations

  • Surface display systems for metal recovery from dilute solutions

  • Improved production of metal-dependent products in biotechnology

These applications typically require protein engineering through directed evolution or rational design to enhance stability, activity, or substrate specificity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.