Recombinant Saccharomyces cerevisiae FIT family protein SCS3 (SCS3)

Shipped with Ice Packs
In Stock

Description

Lipid Metabolism and ER Membrane Biosynthesis

  • Lipid Droplet Formation: SCS3 and its paralog YFT2 facilitate triglyceride partitioning into lipid droplets (LDs), a function conserved with human FIT2 . Heterologous expression of human FIT2 in yeast rescues scs3Δ mutant phenotypes, confirming functional overlap .

  • Phospholipid Biosynthesis: SCS3 regulates transcription of phospholipid biosynthetic genes (e.g., INO1) by modulating Opi1-dependent repression under low inositol conditions . Deletion of SCS3 causes inositol auxotrophy due to reduced phosphatidylinositol synthesis .

  • ER Stress Response: SCS3 maintains ER membrane homeostasis, with deletion strains showing hypersensitivity to cadmium and altered plasma membrane transporter activity .

Genetic and Synthetic Interactions

  • Synthetic Genetic Array (SGA) Analysis:

    • scs3Δ and yft2Δ single/double mutants exhibit synthetic lethality with genes involved in vesicular trafficking, protein synthesis, and lipid metabolism .

    • Key interacting pathways include:

      • Vesicle-mediated transport (e.g., SEC17, VPS21)

      • Translational fidelity (e.g., paromomycin resistance linked to 18S rRNA mutations)

      • Metal ion detoxification (e.g., cadmium hypersensitivity)

Research Applications and Phenotypic Studies

Recombinant SCS3 is widely used to investigate:

  • Mechanisms of Lipid Storage: Studies in yeast and human cell lines demonstrate its role in LD biogenesis .

  • ER Stress Models: scs3Δ strains serve as tools to study ER membrane dysfunction and stress signaling .

  • Functional Complementation: Human FIT2 rescues yeast scs3Δ phenotypes, enabling cross-species functional studies .

Key Research Findings

Phenotype/ObservationMechanistic InsightReferences
Inositol auxotrophyReduced Ino1 activity disrupts phosphatidylinositol synthesis
Paromomycin resistanceLinked to altered translational fidelity and rRNA function
Cadmium hypersensitivityReflects disrupted membrane transporters/ion homeostasis
Complementation by human FIT2Conservation of LD biogenesis and ER stress functions

Future Directions

Ongoing research focuses on:

  • Elucidating SCS3’s role in coordinating phospholipid synthesis with protein translation.

  • Developing yeast models to study human metabolic disorders linked to FIT2 dysfunction.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
SCS3; FIT2B; YGL126W; G2868; Acyl-coenzyme A diphosphatase SCS3; FIT family protein SCS3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-380
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
SCS3
Target Protein Sequence
MSSKWFNAIHLLVCPLTVLVGYLMNAYGYGAALQATLNKDGLVNAMLVKKGWFWTSLVGW WCIIRYRAVPGATGRDRRHIVQSFKRYAILTVWWYVFTQGIWFGVGPIMDLVFVYTGGHC HYDVFDDAGHVNEDFQGSVTRTNRALALIHNVLTLHGHHQEHRQQQLWDRSIGSIQGALQ ATQPKTPKNVTASAAAAINTFIHDQMHRWQGPLTTSAQCRRFGGHWAGGHDPSGHVFLAT LMCMFLLGELRVFGRRALAHLYAQKWQLVRLVTRLFDTGPLWTWRRCGGGSMTCGARLWR AIVEPPVTCAAALLRLTRCIACDHPVIILLTLLVTWLWQLLLTAVASRFHTVREHMSGLL AAYIVTGLVYARDAAALRPV
Uniprot No.

Target Background

Function
SCS3, a recombinant *Saccharomyces cerevisiae* FIT family protein, functions as a fatty acyl-coenzyme A (CoA) diphosphatase. It hydrolyzes fatty acyl-CoA to produce acyl-4'-phosphopantetheine and adenosine 3',5'-bisphosphate. It exhibits a preference for hydrolyzing unsaturated long-chain acyl-CoA substrates within the endoplasmic reticulum (ER) lumen. This enzymatic activity is crucial for maintaining ER structure and facilitating lipid droplet (LD) biogenesis. LDs are lipid storage organelles vital for lipid and energy homeostasis. SCS3 may directly interact with diacylglycerols (DAGs) and triacylglycerols, further contributing to LD biogenesis. It may also support the directional budding of nascent LDs from the ER into the cytosol by modulating DAG levels at LD formation sites. Additionally, SCS3 may play a role in regulating cell morphology and cytoskeletal organization, and is implicated in phospholipid biosynthesis.
Database Links

KEGG: sce:YGL126W

STRING: 4932.YGL126W

Protein Families
FIT family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the SCS3 protein and where is it localized in yeast cells?

SCS3 (Suppressor of Choline Sensitivity 3) is one of the two FIT family homologs found in Saccharomyces cerevisiae (the other being YFT2). It is an endoplasmic reticulum (ER) membrane protein involved in lipid metabolism and cellular homeostasis. SCS3 localizes primarily to the ER membrane, as confirmed by fluorescent tagging and microscopy studies . The protein contains multiple transmembrane domains and is predicted to share the same membrane topology as its homolog YFT2 . Understanding its localization is critical for interpreting its functions in lipid droplet biogenesis and ER homeostasis.

What are the main functions of SCS3 in yeast cells?

SCS3 serves multiple functions in yeast cells, extending beyond its initially described role in lipid droplet formation:

  • Phospholipid homeostasis: SCS3 is essential for maintaining proper phospholipid levels, particularly phosphatidylcholine (PC) and phosphatidylinositol (PI) .

  • Stress response regulation: SCS3 plays a crucial role in the unfolded protein response (UPR) activation during ER stress conditions .

  • Protein quality control: SCS3 influences protein ubiquitylation and the turnover of misfolded proteins .

  • Lipid droplet biogenesis: While early studies suggested a direct role in LD formation, recent research indicates SCS3 may influence LD morphology rather than de novo formation .

These functions position SCS3 at the intersection of lipid metabolism and proteostasis pathways, making it an important focus for research on cellular stress responses.

How does SCS3 differ from its homolog YFT2?

Though SCS3 and YFT2 are both FIT family proteins in yeast with predicted similar membrane topologies, they exhibit distinct functional characteristics:

  • Transcriptional regulation: SCS3 is significantly upregulated upon UPR activation through proteotoxic stress or lipid bilayer stress, while YFT2 shows only mild upregulation .

  • Growth phenotypes: Deletion of SCS3 (scs3Δ) causes growth defects under ER stress conditions (such as tunicamycin treatment), while YFT2 deletion has less pronounced effects .

  • Genetic interactions: SCS3 shows synthetic lethality with IRE1 (the sole UPR transducer in yeast), a relationship not observed with YFT2 .

  • Phospholipid metabolism: SCS3 plays a more significant role in phospholipid homeostasis compared to YFT2 .

These differences suggest that while the proteins may have some overlapping functions, SCS3 has evolved specialized roles in stress response and lipid metabolism pathways.

What expression systems are most effective for recombinant production of SCS3 in yeast?

For recombinant production of membrane proteins like SCS3 in Saccharomyces cerevisiae, several expression systems can be considered. Based on comparative studies of recombinant protein expression in yeast, plasmid-based systems like POTud and CPOTud have shown effectiveness for expressing membrane proteins . When expressing SCS3:

  • Vector selection: Plasmid vectors with strong constitutive promoters (like GPD) or inducible promoters (like GAL) can be used depending on the experimental needs .

  • Leader sequences: The choice between glycosylated leader sequences (like alpha-factor) or synthetic non-glycosylated leaders is important since it affects secretion efficiency and post-translational modifications .

  • Expression kinetics: Consider that expression kinetics may change during growth phases, with some proteins showing higher production during glucose metabolism while others during ethanol metabolism .

Since SCS3 is a membrane protein with multiple transmembrane domains, special consideration should be given to maintaining proper folding and avoiding aggregation during expression.

What are the challenges in purifying functional recombinant SCS3?

Purifying functional recombinant SCS3 presents several challenges common to membrane proteins but also some specific to this FIT family protein:

  • Membrane extraction: Effective solubilization requires optimized detergent conditions to extract SCS3 from ER membranes without destroying its native conformation .

  • Maintaining lipid interaction capabilities: Since SCS3 has putative lipid phosphatase activity, preserving the active site and lipid-binding capacity during purification is critical .

  • Preventing aggregation: As a multi-pass membrane protein, SCS3 has hydrophobic regions that can promote aggregation during purification steps .

  • Protein-protein interactions: SCS3 interacts with various protein partners as revealed by membrane yeast two-hybrid screens, suggesting that isolation may disrupt functionally relevant protein complexes .

A potential approach is to use mild non-ionic detergents combined with lipid reconstitution methods to maintain the native environment required for SCS3 functionality.

How can researchers effectively measure SCS3's impact on phospholipid homeostasis?

To measure SCS3's impact on phospholipid homeostasis, researchers can employ several complementary approaches:

  • Lipid extraction and analysis: Quantify phospholipid species (PC, PI, PS, PE) using techniques like thin-layer chromatography or mass spectrometry from wild-type and scs3Δ mutant cells .

  • Inositol/choline depletion experiments: Culture cells in media with or without inositol and choline, then measure changes in phospholipid composition over time, as performed in the study showing that scs3Δ cells contained four times the PC levels compared to wild-type cells when grown without these precursors .

  • Recovery experiments: Monitor phospholipid synthesis rates during recovery periods after depletion, which revealed that scs3Δ cells fail to increase PI synthesis upon reintroduction of inositol .

  • Genetic interaction studies: Create double mutants lacking SCS3 and other phospholipid synthesis genes (like PCT1) to determine pathway dependencies, as demonstrated in scs3Δ pct1Δ cells showing decreased PC levels compared to scs3Δ alone .

These methods collectively provide insights into how SCS3 influences phospholipid metabolism under different nutritional and stress conditions.

What methods are most reliable for studying SCS3's role in lipid droplet formation?

To study SCS3's role in lipid droplet formation, researchers should consider these methodological approaches:

  • Fluorescent lipid droplet staining: Use BODIPY 493/503 to visualize and quantify lipid droplets in wild-type and scs3Δ cells under normal and stress conditions .

  • Electron microscopy: Examine ultrastructural details of lipid droplet morphology and ER association in cells with normal or mutated SCS3 .

  • Temperature-sensitive mutants: Generate conditional alleles (like scs3-1) to overcome synthetic lethality issues with UPR pathway components and observe acute effects of SCS3 dysfunction .

  • Triacylglycerol quantification: Measure TAG accumulation in the ER versus lipid droplets to determine if SCS3 affects lipid partitioning rather than synthesis .

Research has shown that while scs3Δ mutants can still form lipid droplets with size and number comparable to wild-type under both normal and ER stress conditions, the morphology and complete budding from the ER may be affected .

How does SCS3 interact with the unfolded protein response (UPR) pathway?

The relationship between SCS3 and the UPR pathway is complex and bidirectional:

These findings position SCS3 as both a downstream target and an upstream modulator of the UPR, highlighting its importance in cellular stress responses.

What is the evidence for SCS3's putative lipid phosphatase activity?

The evidence for SCS3's putative lipid phosphatase activity comes from several sources:

  • Sequence analysis: In-depth analysis of ScFIT protein sequences revealed the presence of a catalytic site characteristic of lipid phosphatases .

  • Homology to mammalian FIT2: Mammalian FIT2 has demonstrated capacity to hydrolyze phosphates from phosphatidic acid (PA) and lyso-PA to yield diacylglycerol (DAG) and monoacylglycerol (MAG), respectively, in vitro .

  • Phenotypic evidence: The aberrant ER whorling phenotype observed in cells lacking FIT proteins has been associated with this catalytic function .

  • Phospholipid metabolism effects: scs3Δ cells show altered phospholipid profiles, particularly in PC and PI levels, which is consistent with a role in phospholipid metabolism .

What is known about SCS3's protein-protein interaction network?

SCS3's protein-protein interaction network has been investigated using split-ubiquitin-based membrane yeast two-hybrid (MYTH) screening techniques. Key findings include:

  • Screening methodology: The MYTH screen used reporter moieties fused to either N-terminal or C-terminal cytosolic domains of Scs3 and its homolog Yft2, with optimization using 3'-AT supplementation to reduce false positives .

  • Interaction scope: From 1344 colonies screened across all reporter strains, 664 colonies showed positive bait-prey interactions, identified by blue colony growth on X-gal-supplemented selective medium .

  • Proteostatic machinery: Components of the proteostatic machinery were identified as putative interacting partners of Scs3 .

  • Functional implications: These interactions support a model where ScFITs play important roles in lipid metabolism and proteostasis beyond their initially defined roles in lipid droplet biogenesis .

The specific protein partners identified in this screen provide potential targets for further investigation to understand the mechanistic details of how SCS3 influences cellular processes like protein quality control and lipid metabolism.

What are the key considerations when designing deletion or mutation studies for SCS3?

When designing deletion or mutation studies for SCS3, researchers should consider several critical factors:

  • Synthetic lethality: Complete deletion of SCS3 is synthetic lethal with IRE1 deletion, necessitating alternative approaches when studying SCS3 in UPR-deficient backgrounds .

  • Temperature-sensitive alleles: Creating conditional temperature-sensitive alleles (like scs3-1) can overcome synthetic lethality issues and allow for the study of acute loss of SCS3 function .

  • Functional domains: Consider targeting specific domains of SCS3, such as the putative lipid phosphatase catalytic site, to create function-specific mutations rather than complete gene deletion .

  • Compensatory mechanisms: The UPR provides compensatory mechanisms that mask some phenotypes in scs3Δ cells, so consider UPR inhibition or monitoring when assessing phenotypes .

  • Growth conditions: SCS3-related phenotypes may be more pronounced under specific growth conditions, particularly those involving lipid precursor availability (inositol, choline) or ER stress induction .

These considerations help design experiments that can effectively reveal SCS3's functions while accounting for cellular adaptations that might obscure phenotypes.

How can contradictory findings about SCS3's role in UPR activation be reconciled?

The literature contains contradictory findings regarding SCS3's role in UPR activation. These contradictions can be reconciled through several methodological considerations:

  • Assay sensitivity: Different studies used various methods to measure UPR activation with varying sensitivities. The paper specifically notes that using the UPRE-LacZ reporter assay, they found "no significant UPR activation was observed in scs3Δ mutants, contradicting a previous report while being consistent with other findings" .

  • Growth conditions: UPR activation levels can vary depending on growth conditions, media composition, and growth phase. Standardizing these conditions is essential for comparing results across studies .

  • Strain background differences: Genetic background variations between laboratory strains can influence the degree of UPR activation in response to SCS3 deletion .

  • Temporal considerations: Some phenotypes may develop over time or require specific cellular states to become apparent. The paper notes different protein production kinetics during different growth phases .

  • Compound phenotypes: The combined deletion of both ScFIT genes (scs3Δ yft2Δ) shows more pronounced effects on stress responses than single deletions, suggesting partial functional redundancy that may explain some contradictory findings from single-gene studies .

By carefully controlling these variables and using multiple complementary approaches to measure UPR activation, researchers can better understand the true relationship between SCS3 and the UPR pathway.

What statistical approaches are most appropriate for analyzing phospholipid changes in SCS3 mutants?

When analyzing phospholipid changes in SCS3 mutants, several statistical approaches should be considered:

  • Paired comparisons: Use paired t-tests or Wilcoxon signed-rank tests to compare phospholipid levels between wild-type and scs3Δ mutants under identical conditions to control for batch effects .

  • Time-series analysis: For experiments tracking phospholipid changes over time (as in inositol depletion/readdition studies), repeated measures ANOVA or mixed-effects models are appropriate to account for the correlated nature of time-series data .

  • Multiple comparison correction: When measuring multiple lipid species simultaneously, adjust P-values using methods like Benjamini-Hochberg to control false discovery rates .

  • Normalization methods: Consider appropriate normalization strategies (per cell count, per total phospholipid content, or using internal standards) to ensure comparability across samples .

  • Multivariate analysis: Principal component analysis (PCA) or partial least squares discriminant analysis (PLS-DA) can help identify patterns of coordinated changes across multiple phospholipid species that might not be apparent when analyzing each lipid individually .

These approaches help ensure robust interpretation of the complex lipid changes that occur in response to SCS3 mutation or deletion.

How should researchers interpret the apparent contradictions in lipid droplet formation capacity of SCS3 mutants?

Interpreting contradictions regarding lipid droplet formation in SCS3 mutants requires nuanced consideration of several factors:

By considering these factors, researchers can develop a more comprehensive understanding of SCS3's role that accommodates seemingly contradictory observations.

What are the most promising approaches to identify the specific substrates of SCS3's putative lipid phosphatase activity?

To identify specific substrates of SCS3's putative lipid phosphatase activity, researchers should consider these promising approaches:

  • In vitro enzyme assays: Purify recombinant SCS3 and test its activity against candidate phospholipid substrates including PA, lyso-PA, and other phospholipids using radiometric or colorimetric phosphate release assays .

  • Lipidomic profiling: Perform comprehensive lipidomic analysis of wild-type versus scs3Δ cells, focusing on potential substrate accumulation and product depletion patterns .

  • Structure-function studies: Create targeted mutations in the putative catalytic site and assess both in vitro phosphatase activity and in vivo phospholipid profiles to correlate activity with specific lipid changes .

  • Metabolic labeling: Use radioactive or stable isotope-labeled phospholipid precursors to track metabolic flux through pathways potentially regulated by SCS3's phosphatase activity .

  • Phospholipid sensor tools: Develop and employ fluorescent sensors for specific phospholipids to monitor their spatial and temporal dynamics in living cells with functional or mutated SCS3 .

These approaches, especially when used in combination, could help resolve the current knowledge gap regarding SCS3's enzymatic substrates and provide mechanistic insight into its function in phospholipid homeostasis.

How might research on SCS3 inform our understanding of related human FIT proteins and their role in diseases?

Research on yeast SCS3 can inform our understanding of human FIT proteins and their disease associations through several avenues:

  • Conserved mechanisms: The fundamental mechanisms by which FIT proteins influence lipid metabolism and proteostasis are likely conserved from yeast to humans. Understanding SCS3's role in phospholipid homeostasis and stress responses provides models for human FIT protein functions .

  • Structure-function relationships: Identification of critical domains and residues in SCS3 can guide studies of human FIT proteins, particularly regarding the putative lipid phosphatase activity that may be conserved .

  • Pathway integration: SCS3's connections to the UPR and protein quality control pathways provide insights into how human FIT proteins might be integrated into cellular homeostasis networks, disruption of which is associated with various diseases .

  • Disease modeling: Yeast models with SCS3 mutations can potentially serve as simplified systems to study mechanisms underlying human diseases associated with FIT protein dysfunction, such as lipodystrophies or metabolic disorders .

  • Therapeutic targets: Understanding how cells compensate for SCS3 loss through UPR activation suggests potential compensatory mechanisms that could be therapeutically targeted in human FIT protein-related diseases .

By leveraging the experimental tractability of yeast and the evolutionary conservation of FIT protein functions, research on SCS3 contributes valuable insights into human disease processes involving lipid metabolism and cellular stress responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.