Recombinant Saccharomyces cerevisiae Formation of crista junctions protein 1 (FCJ1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MIC60; SCY_3390; MICOS complex subunit MIC60; Mitofilin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
17-539
Protein Length
Full Length of Mature Protein
Species
Saccharomyces cerevisiae (strain YJM789) (Baker's yeast)
Target Names
MIC60
Target Protein Sequence
ASINTGTTVASKKASHKFRNTFWTIALSATAFYAGGIIYSQKNDKFGDFFSNNVPFAEDL LETYEHYHDRPTLFLEDSWDGLKAKSNDLLSGLTGSSQTRRSNRENIEVKKILSLEPLNI ETENSDPQLKEIIGSLNDLINSLNDSNLSIPESEFNSIKKSNQNMLTNLSQLNETLKEAL SNYMIQRTSEVITELNTQYENSKREFEKNLQKNLLQEVDEFKENLTKQKDKELEEKLKAN EELLQAKHANEVGLLSITQVKEFNKIIKDKIEKERNGRLAHLEEINSEVNDLSKSIDRSS KILSKNEALVQLTFQVDEIKSRINNNNLPDVNIDKELSRLKLLSNLLSTFNKKSCCDDGD CCSCKKGNKNEGKEGKISCKCKPKTNPPSLLSVALDELESTCSGKKILSNEQIYNRWNLL ADDFKTASLLPPNSGILGQLTAKVFSLFLFTKTGNPSNATDFDSVYARVGDNLRVSNLND AVEEVVSLKGWPHKVCESWIEDARRKLEVQRLVEILDCEIRTL
Uniprot No.

Target Background

Function
Recombinant *Saccharomyces cerevisiae* Formation of Crista Junctions protein 1 (FCJ1) is a component of the Mitochondrial Cristae Organization System (MICOS) complex, a large protein assembly within the inner mitochondrial membrane. MICOS plays critical roles in maintaining crista junctions, preserving inner membrane architecture, and establishing contact sites with the outer membrane. FCJ1 specifically contributes to maintaining the connection between cristae membranes and the inner boundary membrane, and it also facilitates protein import via the mitochondrial intermembrane space assembly (MIA) pathway.
Protein Families
MICOS complex subunit Mic60 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is FCJ1 and what is its primary function in Saccharomyces cerevisiae?

FCJ1 (Formation of Crista Junctions protein 1) is a mitochondrial inner membrane protein in Saccharomyces cerevisiae that plays a critical role in the formation and maintenance of crista junctions (CJs). These junctions are tubular invaginations that connect the inner boundary membrane with the cristae membrane in mitochondria. FCJ1 is preferentially localized at these junction points and is essential for their proper formation . When FCJ1 is absent, mitochondria develop abnormal ultrastructure with stacked, concentric cristae and severely reduced numbers of crista junctions, demonstrating its importance in maintaining normal mitochondrial architecture .

How is FCJ1 structurally organized and which domains have been identified?

FCJ1 is a protein of approximately 60 kDa molecular mass with several distinct structural domains:

  • N-terminal region containing a hydrophobic transmembrane segment that anchors the protein to the inner mitochondrial membrane

  • A middle region containing a coiled-coil domain (amino acids 166-342)

  • A C-terminal domain that protrudes into the intermembrane space (IMS)

The C-terminal domain is particularly notable as it represents the most evolutionarily conserved portion of the protein. The N-terminal transmembrane domain faces the mitochondrial matrix, while the large hydrophilic portion containing both the coiled-coil and C-terminal domains extends into the intermembrane space .

What is the relationship between FCJ1 and mammalian mitofilin/IMMT?

FCJ1 in Saccharomyces cerevisiae is the functional ortholog of mammalian mitofilin/IMMT (Inner Membrane Mitochondrial Protein). Both proteins share conserved domains, particularly in the C-terminal region, and perform analogous functions in maintaining crista junction formation in their respective organisms. The mammalian mitofilin/IMMT, like FCJ1, has been shown to be crucial for proper cristae morphology and the formation of crista junctions. This evolutionary conservation underscores the fundamental importance of this protein family in mitochondrial ultrastructure across eukaryotic organisms .

How does the C-terminal domain of FCJ1 contribute to crista junction formation?

The C-terminal domain of FCJ1 is essential for its function in crista junction formation. Research has demonstrated that this domain serves at least two critical functions:

  • It mediates self-interaction with full-length FCJ1, suggesting a role in oligomer formation

  • It interacts with the TOB/SAM complex (Translocase of Outer membrane β-barrel proteins/Sorting and Assembly Machinery)

When the C-terminal domain is absent, formation of crista junctions is severely impaired, with mitochondrial ultrastructure showing irregular, stacked cristae. Quantitative analysis revealed that strains expressing truncated FCJ1 lacking the C-terminal domain (FCJ1 1-472) showed a dramatic reduction in crista junctions to approximately 9% of control levels (see Table 1) .

The interaction between the C-terminal domain and the TOB/SAM complex is particularly significant as it appears to stabilize crista junctions in close proximity to the outer membrane, suggesting that FCJ1 functions as a bridge between the inner and outer mitochondrial membranes through this interaction .

What role does the coiled-coil domain of FCJ1 play in protein function and crista architecture?

The coiled-coil domain of FCJ1 (amino acids 166-342) is crucial for proper crista junction formation. Deletion of this domain (FCJ1 Δ166-342His) severely impacts FCJ1 function despite the protein still being properly localized to the intermembrane space and associated with mitochondrial membranes.

Experimental evidence demonstrates that:

  • Cells expressing FCJ1 without the coiled-coil domain show only partial rescue of the growth defect observed in FCJ1-deficient cells

  • Electron microscopy reveals that these cells have dramatically altered mitochondrial ultrastructure with concentric cristae stacks and very few crista junctions

  • Quantitative analysis showed that deletion of the coiled-coil domain reduced the number of crista junctions to approximately 4% of control levels (see Table 1)

The coiled-coil domain likely mediates protein-protein interactions, either with other FCJ1 molecules or with different mitochondrial proteins, that are essential for the formation and stabilization of crista junctions.

How does the disruption of FCJ1 affect the formation of the MICOS/MINOS/MitOS complex?

FCJ1 has been identified as a component of a large multisubunit complex called MICOS/MINOS/MitOS, which plays a central role in the formation of crista junctions and in determining cristae morphology. The complex contains multiple proteins that work together to maintain proper mitochondrial inner membrane architecture.

This suggests that while FCJ1 is a critical component of the complex, there may be partial redundancy or compensatory mechanisms within the MICOS/MINOS/MitOS system, and different components may contribute differentially to crista junction formation versus other mitochondrial functions that affect cellular growth.

What techniques are effective for generating and validating FCJ1 mutants in Saccharomyces cerevisiae?

Several effective techniques for generating and validating FCJ1 mutants have been established:

Generation of FCJ1 mutants:

  • Site-directed mutagenesis for specific amino acid changes (e.g., G52L mutation in the transmembrane domain)

  • Domain deletion using PCR-based methods (e.g., deletion of the coiled-coil domain amino acids 166-342)

  • Domain swapping with transmembrane segments from other proteins (e.g., replacing FCJ1's transmembrane domain with that of Dld1)

  • Addition of epitope tags (e.g., His12 tag) for detection and purification

Validation methods:

  • PCR analysis using genomic DNA and oligonucleotides that anneal to regions up- and downstream of the FCJ1 locus

  • Sequencing of PCR products to confirm the presence of intended mutations

  • Western blot analysis to confirm protein expression and size

  • Subcellular fractionation to verify proper localization to mitochondria

  • Membrane association assays to confirm integration into mitochondrial membranes

These techniques have been successfully employed to create various FCJ1 mutants including those with altered transmembrane domains (FCJ1 G52L, FCJ1 Dld1-TM), deletion of the coiled-coil domain (FCJ1 Δ166-342His), and C-terminal truncations (FCJ1 1-472) .

How can researchers effectively analyze crista junction formation and mitochondrial ultrastructure in FCJ1 mutants?

Effective analysis of crista junction formation and mitochondrial ultrastructure requires a combination of techniques:

Electron microscopy (EM) approaches:

  • Chemical fixation followed by cryosectioning for ultrastructural analysis

  • Quantification of crista junctions per mitochondrial section in EM images

  • Classification of cristae morphology (e.g., normal, concentric, stacked)

Complementary techniques:

Quantitative analysis:
Researchers can quantify crista junctions per mitochondrial section and express results as a percentage relative to control strains. For example:

StrainRelative number of CJs per mitochondrial section (%)
Δfcj1/Fcj1 DLD1-TM68
Δfcj1/Fcj1 G52L124
Δfcj1/Fcj1 Cyt b246
Δfcj1/Fcj1 Δ166-342His4
Δfcj1/Fcj1 1-4729

This quantitative approach provides clear metrics for comparing the severity of different mutations on crista junction formation .

What protocols can be used to study protein-protein interactions involving FCJ1 in mitochondria?

Several complementary protocols are effective for studying FCJ1 protein-protein interactions:

Affinity purification and mass spectrometry:

  • Generation of tagged FCJ1 constructs (e.g., FCJ1-3xFLAG)

  • Mitochondrial isolation followed by solubilization with appropriate detergents

  • Affinity purification using anti-FLAG antibodies or nickel columns for His-tagged constructs

  • Mass spectrometry identification of co-purifying proteins

  • Validation of interactions through reciprocal pull-downs

Genetic interaction studies:

  • Synthetic Genetic Array (SGA) analysis involving crosses of FCJ1 mutant strains with yeast deletion collections

  • Quantitative scoring of genetic interactions based on colony size

  • Validation of top SGA hits through spot dilution assays, growth curve analyses, and random spore analysis

In vivo crosslinking:

  • Chemical crosslinking of mitochondrial proteins in intact organelles

  • Immunoprecipitation of FCJ1 and interacting partners

  • Western blot or mass spectrometry analysis of crosslinked complexes

These approaches have successfully identified interactions between FCJ1 and components of the TOB/SAM complex, as well as self-interactions that likely contribute to oligomer formation .

How does one interpret the functional significance of different FCJ1 domains based on mutant phenotypes?

Interpreting the functional significance of FCJ1 domains requires careful correlation of multiple phenotypic readouts:

Transmembrane domain interpretation:

Coiled-coil domain interpretation:

C-terminal domain interpretation:

The integration of growth assays, electron microscopy, quantitative crista junction counts, and protein-protein interaction studies provides a comprehensive understanding of domain functionality .

What is the relationship between crista junction number, mitochondrial morphology, and cellular growth?

The relationship between crista junction number, mitochondrial morphology, and cellular growth is complex and not strictly linear:

  • Severe reduction in crista junctions does not always correlate with severe growth defects:

    • The Δfcj1/Fcj1 Δ166-342His strain showed only 4% of normal crista junction numbers but had only partial growth defects

    • Similar observations were made with Aim13/Mcs19 deletion, which reduced crista junction numbers without significantly affecting growth rate

  • Threshold effects may exist:

    • Complete absence of FCJ1 causes both structural defects and growth impairment on non-fermentable carbon sources

    • Partial restoration of crista junction formation may be sufficient for near-normal growth under certain conditions

  • Carbon source dependence:

    • Growth defects in FCJ1 mutants are more pronounced on non-fermentable carbon sources (SLac) compared to fermentable carbon sources (SD)

    • This suggests that proper cristae architecture is particularly important for respiratory function

  • Dominant negative effects:

    • Expression of soluble FCJ1 variants (Fcj1 Cyt b2) in wild-type backgrounds can cause growth impairment even on fermentable carbon sources

    • This indicates that improper localization of FCJ1 can disrupt normal mitochondrial function, possibly through interference with endogenous FCJ1 or related complexes

These observations suggest that while crista junctions are important for optimal mitochondrial function, cells may have compensatory mechanisms that allow adequate growth even with substantially reduced numbers of these structures under certain conditions .

How can researchers distinguish between direct effects of FCJ1 mutations and secondary consequences on mitochondrial structure and function?

Distinguishing between direct and secondary effects of FCJ1 mutations requires multiple experimental approaches:

Temporal studies:

  • Using inducible expression systems to observe the immediate consequences of FCJ1 depletion or mutation

  • Time-course analyses to determine the sequence of events following FCJ1 disruption

Domain-specific analyses:

  • Comparing phenotypes of different domain mutations/deletions to identify specific functions

  • Expressing minimal functional domains to determine which aspects of FCJ1 function they can rescue

Separation of structure and function:

  • Correlating ultrastructural changes with biochemical readouts of mitochondrial function (respiration, membrane potential, protein import)

  • Determining whether structural abnormalities precede or follow functional deficits

Genetic suppressor screening:

  • Identifying mutations that suppress FCJ1 mutation phenotypes

  • These suppressors may highlight pathways that become dysregulated secondarily to FCJ1 dysfunction

Protein interaction network analysis:

  • Mapping changes in the interactome of FCJ1 mutants

  • Identifying which interactions are disrupted first and which are secondary consequences

By integrating these approaches, researchers can build models that separate the primary structural roles of FCJ1 in crista junction formation from secondary effects on energy metabolism, protein import, or other mitochondrial functions .

What are promising approaches for studying the dynamics of FCJ1 localization and function in living cells?

Several innovative approaches hold promise for studying FCJ1 dynamics in living cells:

  • Advanced live-cell microscopy techniques:

    • Super-resolution microscopy (STED, PALM, STORM) to visualize FCJ1 localization at crista junctions below the diffraction limit

    • Fluorescence recovery after photobleaching (FRAP) to study the mobility and turnover of FCJ1 at crista junctions

    • Split-GFP or BIFC systems to visualize protein-protein interactions involving FCJ1 in living cells

  • Optogenetic approaches:

    • Development of light-inducible FCJ1 dimerization or localization systems

    • Acute disruption of FCJ1 interactions to observe immediate consequences on crista junction stability

  • Cryo-electron tomography:

    • Higher resolution structural analysis of crista junctions in wild-type and FCJ1 mutant strains

    • 3D reconstruction of the MICOS/MINOS/MitOS complex architecture

  • Single-particle tracking:

    • Following individual FCJ1 molecules to understand their dynamic behavior

    • Correlating movement patterns with cristae remodeling events

These approaches would provide unprecedented insights into how FCJ1 contributes to the formation, maintenance, and potential remodeling of crista junctions in response to cellular signals or metabolic changes .

How might the study of FCJ1 contribute to understanding human mitochondrial diseases related to mitofilin/IMMT dysfunction?

The study of FCJ1 in yeast can significantly contribute to understanding human mitochondrial diseases through several avenues:

  • Modeling disease mutations:

    • Creating equivalent mutations in FCJ1 that correspond to disease-associated IMMT variants

    • Assessing their effects on mitochondrial ultrastructure and function in the simpler yeast system

  • Therapeutic target identification:

    • Screening for genetic or chemical suppressors of FCJ1 mutant phenotypes

    • Identifying pathways that could be targeted to mitigate consequences of IMMT dysfunction

  • Understanding pathomechanisms:

    • Determining whether disease mutations primarily affect protein stability, localization, or specific protein-protein interactions

    • Identifying which aspects of mitochondrial dysfunction are direct consequences of altered cristae morphology

  • Cross-species validation:

    • Testing whether human IMMT can complement FCJ1 deficiency in yeast

    • Identifying conserved vs. species-specific aspects of crista junction biology

  • Biomarker development:

    • Identifying metabolic signatures of FCJ1 dysfunction that might translate to human diagnostics

    • Developing assays for monitoring therapeutic effectiveness in modulating cristae architecture

These approaches leverage the experimental advantages of yeast (genetic tractability, rapid growth, well-characterized mitochondrial biology) to provide insights relevant to human disease mechanisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.