Recombinant Saccharomyces cerevisiae Glycerol-3-phosphate O-acyltransferase 2 (GPT2)

Shipped with Ice Packs
In Stock

Description

Functional Role in Lipid Metabolism

GPT2 catalyzes the first committed step of TAG synthesis:

  1. Acylation: Transfers acyl-CoA to the sn-1 position of glycerol-3-phosphate, forming lysophosphatidic acid (LPA) .

  2. Pathway Partitioning: Channels substrates toward TAG synthesis via the Kennedy pathway, distinct from the CDP-choline pathway utilized by Gat2p/Sct1p .

  3. Lipid Droplet Biogenesis: Essential for oleate-induced lipid particle (LP) formation, with Gat1p/GPT2 forming ER-associated crescent structures that interact directly with LPs .

Overexpression and Metabolic Engineering

  • TAG Accumulation: Overexpression of codon-optimized GPT2 in S. cerevisiae increased TAG content by 42% (from 223 to 316 mg/g cell dry weight) under standard growth conditions .

  • Substrate Specificity: Prefers palmitoyl-CoA as a substrate, influencing lipid flux toward storage lipids rather than membrane phospholipids .

Regulatory Mechanisms

  • Phosphorylation: Dephosphorylation of GPT2 during oleate stress enhances its activity and relocalization to LPs .

  • Protein Interactions: Physically interacts with:

    • Pah1p: A phosphatidic acid hydrolase critical for TAG synthesis .

    • Casein Kinase 2 (CK2): Phosphorylates GPT2, modulating its activity .

Phenotypic Effects of Deletion

ConditionPhenotype of gpt2ΔCitation
Oleate stressFailed LP formation; sensitivity to oleate toxicity
Standard growth30% reduction in TAG synthesis; altered phospholipid ratios

Applications in Biotechnology

  • Biofuel Production: Enhanced TAG accumulation in GPT2-engineered yeast strains improves lipid yields for biodiesel precursors .

  • Metabolic Disease Models: Insights into GPT2’s role in lipid homeostasis inform studies on obesity and fatty liver disease .

Comparative Analysis of GPAT Isoforms in S. cerevisiae

FeatureGPT2 (Gat1p)Gat2p/Sct1p
LocalizationER and lipid particlesER
Primary PathwayTAG synthesis (Kennedy pathway)Phospholipid synthesis
Oleate ResponseInduces crescent structures and LP formationNo structural changes observed
Enzyme ActivityEnhanced by dephosphorylationConstitutively active

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
GPT2; GAT1; YKR067W; Glycerol-3-phosphate O-acyltransferase 2; G-3-P acyltransferase 2; GPAT 2; Dihydroxyacetone phosphate acyltransferase 2; DHAP-AT 2; Glycerol-3-phosphate / dihydroxyacetone phosphate acyltransferase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-743
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
GPT2
Target Protein Sequence
MSAPAADHNAAKPIPHVPQASRRYKNSYNGFVYNIHTWLYDVSVFLFNILFTIFFREIKV RGAYNVPEVGVPTILVCAPHANQFIDPALVMSQTRLLKTSAGKSRSRMPCFVTAESSFKK RFISFFGHAMGGIPVPRIQDNLKPVDENLEIYAPDLKNHPEIIKGRSKNPQTTPVNFTKR FSAKSLLGLPDYLSNAQIKEIPDDETIILSSPFRTSKSKVVELLTNGTNFKYAEKIDNTE TFQSVFDHLHTKGCVGIFPEGGSHDRPSLLPIKAGVAIMALGAVAADPTMKVAVVPCGLH YFHRNKFRSRAVLEYGEPIVVDGKYGEMYKDSPRETVSKLLKKITNSLFSVTENAPDYDT LMVIQAARRLYQPVKVRLPLPAIVEINRRLLFGYSKFKDDPRIIHLKKLVYDYNRKLDSV GLKDHQVMQLKTTKLEALRCFVTLIVRLIKFSVFAILSLPGSILFTPIFIICRVYSEKKA KEGLKKSLVKIKGTDLLATWKLIVALILAPILYVTYSILLIILARKQHYCRIWVPSNNAF IQFVYFYALLVFTTYSSLKTGEIGVDLFKSLRPLFVSIVYPGKKIEEIQTTRKNLSLELT AVCNDLGPLVFPDYDKLATEIFSKRDGYDVSSDAESSISRMSVQSRSRSSSIHSIGSLAS NALSRVNSRGSLTDIPIFSDAKQGQWKSEGETSEDEDEFDEKNPAIVQTARSSDLNKENS RNTNISSKIASLVRQKREHEKKE
Uniprot No.

Target Background

Function
Dual substrate-specific glycerol-3-phosphate/dihydroxyacetone phosphate sn-1 acyltransferase, catalyzing the first and committed reaction in the de novo synthesis of glycerophospholipids and triacylglycerols (TAGs). It utilizes both Gly-3-P and dihydroxyacetone phosphate with similar efficiencies and exhibits a broad fatty acyl-CoA specificity profile. It transfers a fatty acid from fatty acyl-CoA to the sn-1 position of glycerol-3-phosphate, producing lysophosphatidic acid (LysoPA). These lipids are not only precursors of glycerolipids but also serve as dynamic components of signal transduction systems that regulate cellular physiology.
Gene References Into Functions
  1. Research suggests that motifs I, II, and III of Gpt2p are located within the lumen of the endoplasmic reticulum (ER). This supports the notion that the active site of Gpt2p resides in the ER lumen PMID: 23016825
Database Links

KEGG: sce:YKR067W

STRING: 4932.YKR067W

Protein Families
GPAT/DAPAT family
Subcellular Location
Lipid droplet. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Glycerol-3-phosphate O-acyltransferase 2 (GPT2) and what is its primary function in yeast?

Glycerol-3-phosphate O-acyltransferase 2 (GPT2, also known as GAT1) is an enzyme in Saccharomyces cerevisiae that catalyzes the acylation of glycerol-3-phosphate, representing a critical step in phospholipid and triacylglycerol biosynthesis. It functions as part of a complex lipid synthesis system alongside other acyltransferases. This enzyme specifically transfers fatty acyl groups from acyl-CoA to the sn-1 position of glycerol-3-phosphate, producing lysophosphatidic acid, which serves as a precursor for various phospholipids and neutral lipids. GPT2 is one of two main glycerol-3-phosphate 1-O-acyltransferases in yeast, working in coordination with Gat1p and complemented by two main 1-acylglycerol-3-phosphate O-acyltransferases (Lpt1p, Slc1p) .

How does GPT2 differ from other acyltransferases in yeast?

GPT2 (Gat2p) is specifically a glycerol-3-phosphate 1-O-acyltransferase that primarily functions at the initial step of glycerophospholipid synthesis. While it shares functional similarity with Gat1p (the other main glycerol-3-phosphate 1-O-acyltransferase), research has demonstrated that these enzymes have distinct substrate preferences and contribute uniquely to phospholipid heterogeneity. Studies using compound mutations have shown that strains with different combinations of acyltransferase mutations (such as gat1Δlpt1Δ, gat2Δlpt1Δ, gat1Δslc1Δ, and gat2Δslc1Δ) display varying phospholipid profiles . GPT2/Gat2p appears to work in a pathway distinct from Gat1p, with dramatic differences in phospholipid composition observed in gat2Δslc1Δ mutants compared to wild type, while gat1Δlpt1Δ mutations produced fewer changes. This suggests specific roles for each acyltransferase in determining phospholipid acyl chain composition and distribution .

What are the structural characteristics of recombinant Saccharomyces cerevisiae GPT2?

Recombinant Saccharomyces cerevisiae GPT2 is typically produced as a protein with preserved structural and functional characteristics of the native enzyme. When expressed in heterologous systems (E. coli, yeast, baculovirus, or mammalian cells), the purified protein generally has a purity of ≥85% as determined by SDS-PAGE . The recombinant protein contains the catalytic domains necessary for acyltransferase activity, including binding sites for both the glycerol-3-phosphate substrate and the acyl-CoA donor. While the full three-dimensional structure details are not provided in the search results, the functional domains must be preserved for activity. Researchers often use recombinant forms with various tags (such as His-tags) to facilitate purification and characterization while maintaining enzymatic function. The recombinant protein must maintain proper folding of the catalytic center to preserve its ability to catalyze the transfer of acyl groups.

What expression systems are most effective for producing recombinant Saccharomyces cerevisiae GPT2?

Multiple expression systems have been successfully employed to produce recombinant Saccharomyces cerevisiae GPT2, each with specific advantages depending on the research objectives. Four primary expression hosts are commonly used: E. coli, yeast, baculovirus, and mammalian cell systems . For basic characterization studies and when large quantities are needed, E. coli systems offer cost-effective and rapid production, though proper folding may be a concern for some applications. Yeast expression systems (particularly S. cerevisiae itself) provide the advantage of native post-translational modifications and proper folding within the organism of origin. Baculovirus-insect cell systems are beneficial when higher eukaryotic processing is desired without the complexity of mammalian systems. Mammalian cell expression is preferred when studying interactions with mammalian proteins or when complex eukaryotic modifications are essential for the experimental design. The choice depends on research requirements such as yield needs, downstream applications, and whether post-translational modifications are critical for the specific experiment.

How should researchers design mutation studies to investigate GPT2 function in lipid metabolism?

When designing mutation studies to investigate GPT2 function in lipid metabolism, researchers should employ a systematic approach that considers both the unique and redundant aspects of acyltransferase functions. Based on previous successful studies, the following methodology is recommended:

  • Create both single gene knockouts (gpt2Δ) and compound mutations involving related acyltransferases (such as gat1Δlpt1Δ, gat2Δlpt1Δ, gat1Δslc1Δ, and gat2Δslc1Δ) to uncover functional redundancies and unique contributions .

  • Employ complementary analytical techniques such as:

    • Radiolabeling assays with precursors like [³H]palmitic acid to track incorporation into phospholipids versus triacylglycerols

    • Electrospray ionization tandem mass spectrometry (ESI-MS/MS) to characterize changes in phospholipid species profiles

    • Growth assays under stress conditions (temperature extremes, ethanol exposure) to assess physiological impacts

  • Perform rescue experiments by expressing the wild-type gene from plasmids in mutant backgrounds to confirm specificity of observed phenotypes.

  • Include controls for growth rate differences and assess multiple growth conditions to identify condition-specific dependencies on GPT2 function.

This approach has successfully revealed unique contributions of each acyltransferase to phospholipid heterogeneity, with specific combinations showing distinctive profiles of acyl chain length, saturation, and pairing in membrane phospholipids .

What analytical techniques are most informative for characterizing GPT2 enzymatic activity?

Several analytical techniques provide complementary information when characterizing GPT2 enzymatic activity, with the most informative approaches including:

  • In vitro enzyme activity assays: Using purified recombinant GPT2 with radiolabeled substrates (such as [³H]glycerol-3-phosphate and various acyl-CoA species) to determine kinetic parameters (Km, Vmax) and substrate specificities.

  • Lipidomic analysis by mass spectrometry: Electrospray ionization tandem mass spectrometry (ESI-MS/MS) provides detailed characterization of phospholipid species, revealing the types of acyl chains incorporated by GPT2 and the resulting phospholipid profiles . This technique can detect subtle changes in acyl chain composition, length, and saturation levels.

  • Radiolabeling studies: Tracking the incorporation of labeled fatty acids (e.g., [³H]palmitic acid) into different lipid classes helps quantify the relative distribution of GPT2 activity toward phospholipid versus triacylglycerol synthesis pathways .

  • Genetic complementation assays: Testing the ability of wild-type or mutant GPT2 to rescue phenotypes in acyltransferase-deficient strains provides functional insights into specific domains and residues.

These techniques should be applied in combination for a comprehensive understanding of GPT2 function, as enzymatic activity in vitro may differ from the enzyme's role in the complex cellular environment.

How should researchers interpret changes in phospholipid profiles when studying GPT2 mutants?

When interpreting changes in phospholipid profiles from GPT2 mutant studies, researchers should employ a systematic analytical framework that considers multiple aspects of lipid metabolism:

  • Acyl chain specificity analysis: Compare the distribution of acyl chain lengths and saturation levels in phospholipids between wild-type and mutant strains. For instance, significant research has shown that yeast expressing specific acyltransferase combinations (e.g., Gat1p and Lpt1p) produce phospholipids enriched with characteristic features such as unsaturated bonds, 18-carbon chains, and specific length pairings .

  • Phospholipid class distribution: Examine changes in the relative abundance of different phospholipid classes (e.g., phosphatidylcholine, phosphatidylethanolamine, phosphatidylserine) as compensatory metabolic adjustments may occur.

  • Correlation with phenotypic manifestations: Link specific phospholipid alterations to observable phenotypes, such as growth defects under stress conditions. For example, certain acyltransferase mutations have been shown to prevent growth at low temperatures (18.5°C) and in the presence of 10% ethanol .

  • Pathway flux analysis: Consider how mutations affect the balance between different lipid synthesis pathways, particularly the relative incorporation of fatty acids into phospholipids versus triacylglycerols, which can be quantified through radiolabeling experiments .

  • Comparative analysis across multiple mutant combinations: Evaluate the severity of changes across different mutant combinations (e.g., gat1Δlpt1Δ showing few differences from wild type versus gat2Δslc1Δ displaying dramatic alterations) to determine the relative contributions of each acyltransferase.

This comprehensive approach helps distinguish primary effects of GPT2 deficiency from secondary compensatory responses and provides insight into the specific role of GPT2 in maintaining membrane lipid homeostasis.

What statistical approaches are most appropriate for analyzing GPT2 function in large-scale lipidomic datasets?

When analyzing GPT2 function through large-scale lipidomic datasets, researchers should implement a multi-layered statistical approach that addresses both targeted hypothesis testing and broader pattern discovery:

  • Multivariate analysis techniques: Principal Component Analysis (PCA) and Partial Least Squares Discriminant Analysis (PLS-DA) are particularly valuable for reducing dimensionality in complex lipidomic datasets and identifying key lipid species that differentiate between experimental groups (e.g., wild-type versus various GPT2 mutants).

  • ANOVA with post-hoc testing: For comparing multiple experimental conditions (different mutant combinations, growth conditions, etc.), Analysis of Variance followed by appropriate post-hoc tests (Tukey's HSD or Bonferroni correction) helps control for multiple testing while identifying significantly altered lipid species.

  • Correlation networks: Creating correlation networks between lipid species can reveal co-regulated lipids and pathway relationships affected by GPT2 mutations, providing insight into the broader impact on lipid metabolism.

  • Hierarchical clustering: This approach groups lipid species and experimental conditions based on similarity patterns, helping identify clusters of lipids similarly affected by GPT2 activity.

  • Time-series analysis: For experiments tracking changes over time (e.g., during stress response), mixed-effects models can account for both fixed effects (genotype, treatment) and random effects (time, biological replicate).

The statistical approach should be complemented by thorough quality control procedures, including normalization methods appropriate for mass spectrometry data (such as internal standard normalization or total ion current normalization) and rigorous handling of missing values. These approaches collectively provide robust identification of lipid species and pathways specifically affected by GPT2 function.

How can researchers differentiate between direct effects of GPT2 alterations and compensatory metabolic responses?

Differentiating between direct effects of GPT2 alterations and compensatory metabolic responses requires a multi-faceted experimental approach:

  • Temporal analysis: Conduct time-course experiments following GPT2 inactivation (using inducible systems or temperature-sensitive alleles) to distinguish immediate effects (likely direct) from delayed changes (potentially compensatory). Early alterations in specific lysophosphatidic acid species or particular acyl chain distributions are more likely to represent direct consequences of GPT2 deficiency.

  • Dose-dependent responses: For partial loss-of-function alleles or titrated expression systems, establish dose-response relationships. Direct effects typically show proportional relationships to enzyme activity levels, while compensatory mechanisms may exhibit threshold effects or non-linear responses.

  • Combined genetic approaches: Create and analyze double or triple mutants affecting both GPT2 and potential compensatory pathways. For example, combining gpt2Δ with mutations in other acyltransferases (gat1Δ, slc1Δ, lpt1Δ) has revealed specific collaborative and unique functions . If removing a putative compensatory pathway exacerbates GPT2 deficiency phenotypes, this supports a compensatory role.

  • Transcriptional and proteomic profiling: Identify changes in expression of other lipid metabolism enzymes that occur in response to GPT2 deficiency, as these likely represent compensatory adaptations.

  • Substrate accumulation analysis: Direct effects of GPT2 deficiency should lead to accumulation of its substrates (glycerol-3-phosphate and acyl-CoAs) and reduction of immediate products (lysophosphatidic acid with specific acyl chains). Secondary effects may involve more distant metabolites.

  • In vitro validation: Reconstitute reactions with purified components to confirm direct catalytic relationships identified in cellular studies.

Through this systematic approach, researchers can build a comprehensive model distinguishing the primary functions of GPT2 from the broader metabolic adjustments that occur when its activity is altered.

How does GPT2 activity coordinate with other enzymes in the phospholipid biosynthesis pathway?

GPT2 functions within an intricate network of enzymes involved in phospholipid biosynthesis, with sophisticated coordination mechanisms that ensure proper membrane composition:

  • Substrate channeling and enzyme complexes: GPT2 likely participates in physical or functional complexes with other lipid biosynthetic enzymes, creating metabolic channels that efficiently direct intermediates through the pathway. Evidence from compound mutation studies suggests specific functional relationships between pairs of acyltransferases, such as between GPT2/Gat2p and Slc1p, as gat2Δslc1Δ double mutants show particularly dramatic alterations in phospholipid profiles .

  • Regulatory cross-talk: GPT2 activity appears to be coordinated with 1-acylglycerol-3-phosphate O-acyltransferases (Lpt1p, Slc1p) that catalyze the next step in phospholipid synthesis. This coordination ensures balanced production of intermediate lipid species and prevents accumulation of potentially disruptive lysophospholipids.

  • Acyl-CoA pooling and preference: GPT2 shows specific preferences among the four main acyl-CoA species present in yeast, and this selectivity contributes to the final phospholipid composition. The enzyme appears to work with specific downstream acyltransferases to incorporate particular combinations of acyl chains, as evidenced by the finding that yeast expressing Gat1p and Lpt1p produce phospholipids enriched with unsaturated, 18-carbon acyl chains arranged in specific pairing patterns .

  • Metabolic branch point regulation: As GPT2 catalyzes an early step in a pathway that branches to form both phospholipids and triacylglycerols, its activity must be regulated in coordination with enzymes that direct flux toward either membrane lipids or storage lipids. Mutations in GPT2 and related acyltransferases have been shown to affect the relative incorporation of fatty acids into these different lipid classes .

  • Environmental response synchronization: The coordination between GPT2 and other lipid biosynthetic enzymes responds to environmental conditions, as evidenced by growth defects of specific acyltransferase mutant combinations under stress conditions like low temperature (18.5°C) and ethanol exposure (10%) . This suggests coordinated regulation of these enzymes to adapt membrane composition to environmental challenges.

Understanding these coordination mechanisms is crucial for developing a comprehensive model of how cells regulate membrane lipid composition through the activities of multiple acyltransferases with overlapping yet distinct functions.

What are the challenges in distinguishing between the functions of GPT2 and other acyltransferases with overlapping activities?

Researchers face several significant challenges when attempting to distinguish the specific functions of GPT2 from other acyltransferases with overlapping activities:

  • Functional redundancy: Saccharomyces cerevisiae contains multiple acyltransferases with overlapping substrate specificities, including two main glycerol-3-phosphate 1-O-acyltransferases (Gat1p/GPT1 and Gat2p/GPT2) and two main 1-acylglycerol-3-phosphate O-acyltransferases (Lpt1p and Slc1p) . This redundancy means that single gene deletions often produce subtle phenotypes, as other enzymes can partially compensate for the loss.

  • Context-dependent activity: The relative contributions of different acyltransferases vary depending on environmental conditions, growth phase, and metabolic state. For example, specific acyltransferase combinations show growth defects only under particular stress conditions, such as low temperature or ethanol exposure , making their unique functions difficult to detect under standard laboratory conditions.

  • Complex substrate preferences: Each acyltransferase exhibits preferences for particular acyl-CoA species that may overlap partially but not completely with other family members. These preferences may also change depending on substrate availability and cellular conditions, complicating the assignment of specific roles.

  • Interconnected metabolic networks: Changes in one acyltransferase's activity can trigger compensatory adjustments in other enzymes and pathways, creating complex patterns of altered lipid profiles that are difficult to attribute to specific enzymatic functions.

  • Technical limitations in assaying specific activities: In vitro assays may not fully recapitulate the in vivo substrate preferences and activities of these enzymes, as cellular contexts provide specific membrane environments, protein-protein interactions, and regulatory factors.

To overcome these challenges, researchers have successfully employed compound mutation approaches (e.g., gat1Δlpt1Δ, gat2Δlpt1Δ, gat1Δslc1Δ, and gat2Δslc1Δ) combined with comprehensive lipidomic profiling and growth assays under various conditions. This strategy has revealed that each acyltransferase combination creates distinct phospholipid profiles, with GPT2/Gat2p appearing to have particularly important functions that cannot be fully compensated by other enzymes, as evidenced by the dramatic phospholipid alterations in gat2Δslc1Δ mutants .

What role does GPT2 play in cellular adaptation to environmental stress conditions?

GPT2 plays a crucial role in cellular adaptation to environmental stress through its contribution to membrane lipid remodeling:

  • Temperature adaptation: Research has demonstrated that specific acyltransferase combinations, particularly those involving GPT2/Gat2p, are essential for growth at low temperatures (18.5°C) . This suggests that GPT2's activity in incorporating specific acyl chains into phospholipids is critical for maintaining appropriate membrane fluidity at lower temperatures, when membranes tend to become more rigid.

  • Ethanol stress resistance: Yeast strains with particular acyltransferase mutations, including those affecting GPT2-related pathways, show inability to grow in the presence of 10% ethanol . This indicates that GPT2 contributes to creating membrane lipid compositions that resist the fluidizing and disruptive effects of ethanol on cellular membranes.

  • Metabolic flexibility: As a key enzyme at a branch point in lipid metabolism, GPT2 helps cells balance the synthesis of membrane phospholipids versus storage triacylglycerols depending on environmental conditions. Alterations in GPT2 function affect the incorporation of fatty acids into these different lipid classes , potentially allowing cells to prioritize either membrane remodeling or energy storage depending on stress conditions.

  • Membrane phospholipid remodeling: GPT2, working with specific downstream acyltransferases, creates phospholipids with distinct characteristics such as acyl chain unsaturation, length, and pairing patterns . These properties directly affect membrane physical characteristics including fluidity, permeability, and protein functionality, which must be adjusted during stress responses.

  • Signaling lipid production: The acylation reactions catalyzed by GPT2 contribute to the pool of lipid intermediates that may serve as precursors for signaling molecules involved in stress response pathways.

The critical nature of GPT2's role in stress adaptation is highlighted by the observation that yeast expressing only certain acyltransferase combinations (specifically Gat1p and Lpt1p) produce phospholipids with characteristic features (unsaturated, 18-carbon chains with specific pairing patterns) that prevent growth under stress conditions . This demonstrates that the specific acyl chain distribution in membrane phospholipids, which is partially determined by GPT2 activity, is essential for cellular adaptation to environmental challenges.

What evolutionary insights can be gained from comparing GPT2 across different yeast species?

Evolutionary analysis of GPT2 across yeast species provides valuable insights into lipid metabolism adaptation and functional conservation:

  • Functional conservation and divergence: Comparative genomic analyses reveal that while GPT2 orthologs are present across different yeast species, their sequence conservation patterns highlight functionally critical regions versus areas that have diverged to accommodate species-specific metabolic requirements. The core catalytic domains typically show higher conservation, while regulatory regions may exhibit greater divergence.

  • Niche adaptation signatures: Species adapted to different ecological niches show characteristic variations in their GPT2 sequences and activities. These variations often correlate with the typical environmental challenges faced by each species, such as temperature ranges, osmotic conditions, or available carbon sources, which necessitate specific membrane lipid compositions.

  • Gene duplication patterns: The presence of two main glycerol-3-phosphate acyltransferases in S. cerevisiae (GPT2/Gat2p and Gat1p) represents a gene duplication event that has allowed functional specialization. Evolutionary analysis across yeast phylogeny can reveal when this duplication occurred and how the functions of these paralogs have diverged over time.

  • Substrate preference evolution: Differences in substrate preferences between GPT2 orthologs from different yeast species reflect evolutionary adaptations to available fatty acid pools and required membrane compositions in their respective environments. These preferences manifest in the acyl chain distributions observed in phospholipids when different orthologs are expressed.

  • Co-evolution with partner enzymes: GPT2 functions in coordination with other enzymes in the phospholipid synthesis pathway, such as 1-acylglycerol-3-phosphate O-acyltransferases (Lpt1p, Slc1p). Comparative genomics can reveal patterns of co-evolution between these functionally related enzymes, with correlated changes suggesting maintenance of functional interactions.

  • Lineage-specific losses and gains: Some yeast lineages may have lost or gained specific GPT2 functions or regulatory mechanisms, potentially compensated by alterations in other aspects of lipid metabolism. These patterns provide insights into the evolutionary plasticity of phospholipid biosynthesis pathways.

The evolutionary history of GPT2 thus illustrates how a core metabolic enzyme can adapt to different environmental pressures while maintaining its essential catalytic function, contributing to the remarkable diversity and adaptability of yeast species across various ecological niches.

How do the phospholipid profiles resulting from GPT2 activity differ from those produced by other acyltransferase combinations?

The phospholipid profiles resulting from GPT2 activity exhibit distinctive characteristics compared to those produced by other acyltransferase combinations, with significant implications for membrane properties:

Acyltransferase CombinationPhospholipid Profile CharacteristicsFunctional ConsequencesResearch Evidence
GPT2/Gat2p + Slc1p (wild type)Balanced distribution of acyl chain lengths and saturation levelsNormal growth across various conditionsDramatic alterations in phospholipid profiles when both enzymes are deleted (gat2Δslc1Δ)
Gat1p + Lpt1pEnriched in unsaturated, 18-carbon acyl chains with specific pairing patternsUnable to grow at low temperature (18.5°C) and in 10% ethanolExperimental validation in compound mutant studies
Gat2p + Lpt1pIntermediate alterations in phospholipid profiles compared to wild typeSpecific adaptation capabilitiesIntermediate changes observed in gat2Δlpt1Δ mutants
Gat1p + Slc1pIntermediate alterations in phospholipid profiles compared to wild typeSpecific adaptation capabilitiesIntermediate changes observed in gat1Δslc1Δ mutants

The most striking differences are observed between wild-type phospholipid profiles (utilizing GPT2/Gat2p and Slc1p) and those produced by yeast expressing only Gat1p and Lpt1p. The latter combination results in phospholipids with distinctive features: higher levels of unsaturation, predominance of 18-carbon acyl chains, and specific pairing patterns . These differences are functionally significant, as demonstrated by the inability of yeast with this phospholipid profile to grow under stress conditions such as low temperature (18.5°C) and 10% ethanol exposure .

Mass spectrometry analysis reveals that the acyl chain composition and distribution across different phospholipid classes varies significantly depending on which acyltransferases are active. Wild-type profiles (with GPT2/Gat2p contributing) show more diversity in acyl chain types, lengths, and combinations, suggesting that GPT2 has broader substrate utilization capabilities or works with Slc1p to generate more diverse phospholipid species.

The specific phospholipid characteristics resulting from different acyltransferase combinations directly affect membrane physical properties such as fluidity, thickness, and curvature, which in turn influence membrane protein function, cellular adaptation capabilities, and stress resistance. The distinctive phospholipid profile resulting from GPT2 activity appears to be particularly important for adaptation to environmental challenges, as evidenced by the growth defects observed when this enzyme's contribution is absent .

What are the most significant recent advances in understanding GPT2 function?

Recent advances in understanding GPT2 function have significantly expanded our knowledge of this enzyme's role in lipid metabolism and cellular adaptation. The most notable progress has come from comprehensive lipidomic analyses combined with sophisticated genetic approaches. Particularly significant is the realization that GPT2/Gat2p works in a coordinated manner with specific downstream acyltransferases, especially Slc1p, to generate phospholipid profiles that are essential for cellular adaptation to environmental stresses . The dramatic alterations in phospholipid composition observed in gat2Δslc1Δ double mutants, compared to the more modest changes in other acyltransferase mutant combinations, have revealed the unique and non-redundant contribution of GPT2 to membrane lipid heterogeneity .

Additionally, advanced mass spectrometry techniques have illuminated the specific characteristics of phospholipids resulting from different acyltransferase combinations, showing that GPT2 contributes to creating lipid profiles with particular acyl chain distributions, lengths, and saturation patterns that directly impact membrane physical properties and stress resistance. The finding that yeast expressing alternative acyltransferase combinations (specifically Gat1p and Lpt1p) produce phospholipids with characteristics that prevent growth under stress conditions highlights the critical nature of proper acyl chain incorporation by GPT2 .

Together, these advances have shifted our understanding from viewing GPT2 simply as one of several redundant enzymes to recognizing it as a key contributor to membrane lipid diversity with specific functions that cannot be fully compensated by other acyltransferases. This enhanced understanding opens new avenues for manipulating membrane composition in biotechnological applications and provides insights into fundamental aspects of cellular adaptation to environmental challenges.

What are the most promising future research directions for GPT2 studies?

Several promising research directions for GPT2 studies hold potential for significant scientific and practical advances:

  • Structural biology approaches: Determining the three-dimensional structure of GPT2 through X-ray crystallography or cryo-electron microscopy would provide crucial insights into its substrate-binding mechanisms, catalytic mechanism, and the structural basis for its unique acyl-CoA preferences. This structural information could enable rational design of GPT2 variants with altered substrate specificities for biotechnological applications.

  • Systems biology integration: Developing comprehensive models that integrate GPT2 activity with global cellular metabolism would help elucidate how phospholipid synthesis is coordinated with other metabolic pathways and how these relationships are altered under different environmental conditions. This could include flux balance analysis models incorporating lipid metabolism and multi-omics approaches that correlate transcriptomic, proteomic, and lipidomic data.

  • Synthetic biology applications: Engineering GPT2 variants with tailored substrate preferences could enable the production of designer phospholipids with specific properties for industrial applications. Combining these engineered enzymes with metabolic engineering approaches could create yeast strains that produce valuable specialized lipids.

  • Environmental adaptation mechanisms: Further investigation of how GPT2 activity contributes to adaptation to specific environmental stresses could provide insights into fundamental mechanisms of cellular resilience. This includes detailed analysis of membrane physical properties resulting from GPT2-dependent phospholipid profiles under various stress conditions.

  • Regulatory network mapping: Elucidating the regulatory mechanisms controlling GPT2 expression and activity would enhance understanding of how cells modulate membrane composition in response to changing conditions. This could include identification of transcription factors, post-translational modifications, and allosteric regulators that influence GPT2 function.

  • Comparative genomics expansion: Extending comparative studies of GPT2 across diverse yeast species and connecting sequence variations to functional differences and ecological niches would provide evolutionary insights into lipid metabolism adaptation.

These research directions collectively promise to advance both fundamental understanding of phospholipid metabolism and practical applications in biotechnology, synthetic biology, and industrial microbiology.

How might understanding GPT2 function contribute to broader applications in biotechnology?

Understanding GPT2 function offers several promising pathways for biotechnological applications:

  • Engineered lipid production platforms: Detailed knowledge of GPT2's substrate preferences and activity mechanisms enables the development of yeast strains with modified acyltransferase activities. These engineered strains could produce specialized phospholipids with defined acyl chain compositions for applications in pharmaceuticals, nutraceuticals, and cosmetics. By manipulating GPT2 and complementary enzymes, researchers could create yeast "cell factories" that produce high-value lipids with specific properties.

  • Stress-resistant industrial strains: The critical role of GPT2 in creating phospholipid profiles that enable adaptation to environmental stresses such as temperature extremes and ethanol exposure has direct applications in industrial fermentation. Engineering GPT2 activity in industrial yeast strains could enhance their tolerance to process-relevant stresses, improving productivity and efficiency in biofuel production, brewing, and other fermentation processes.

  • Membrane engineering for enhanced cellular capabilities: The ability of GPT2 to influence membrane composition offers opportunities to engineer cellular membranes with altered permeability, fluidity, and protein functionality. This could enable enhanced uptake of specific compounds, improved secretion of products, or optimized activity of membrane-associated enzymes in biotechnological processes.

  • Lipid-based drug delivery systems: Understanding how GPT2 contributes to specific phospholipid compositions could inform the development of lipid-based drug delivery vehicles with tailored properties. Phospholipids with defined acyl chain compositions produce liposomes with specific stability, permeability, and tissue targeting capabilities.

  • Metabolic flux optimization: Knowledge of how GPT2 functions at a branch point between membrane lipid and storage lipid synthesis pathways enables strategic manipulation of carbon flux in yeast. This could be applied to redirect carbon toward valuable products by adjusting the balance between membrane building and storage compound accumulation.

  • Biosensors for lipid metabolism: GPT2 activity and its resulting phospholipid profiles could serve as the basis for biological sensors that detect and respond to specific environmental conditions or metabolic states, with applications in environmental monitoring and bioprocess control.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.