Recombinant Saccharomyces cerevisiae Golgi to ER traffic protein 1 (GET1)

Shipped with Ice Packs
In Stock

Description

Introduction to GET1

The GET1 protein, or Recombinant Saccharomyces cerevisiae Golgi to ER traffic protein 1, is involved in the retrograde transport from the Golgi to the endoplasmic reticulum (ER) in yeast cells . This retrograde transport is crucial for maintaining the integrity of both the ER and the Golgi complex by retrieving transport factors, cargo receptors, and ER-resident proteins that may have escaped the ER retention system .

Role of Ypt1p in Golgi-ER Trafficking

Ypt1p, a small GTPase of the Rab family, plays a vital role in the docking of ER-derived transport vesicles with the Golgi before fusion . Studies indicate that Ypt1p is essential for retrograde transport from the Golgi to the ER and for maintaining the morphology and protein composition of the Golgi .

Ypt1p is essential for retrograde Golgi-ER transport and for Golgi .

COPI and COPII Vesicles

Protein transport between the ER and the Golgi is facilitated by COPI and COPII vesicles . COPII vesicles transport cargo proteins from the ER to the Golgi, while COPI vesicles are responsible for retrograde transport, returning proteins and lipids from the Golgi back to the ER . The formation of COPI vesicles is influenced by ADP-ribosylation factor GTP activating proteins, such as Gcs1p and Glo3p .

SEC16 and its Impact on Protein Secretion

SEC16, an ER peripheral protein, accumulates at ER exit sites (ERESs) and acts as a scaffold for the formation of COPII vesicles . Overexpression of SEC16 can enhance recombinant protein secretion in S. cerevisiae by facilitating the formation of COPII vesicles and increasing the flux of ER-to-Golgi transportation .

GUP1 and its Effects on ER and Golgi Structures

High-level expression of the GUP1 gene in Saccharomyces cerevisiae results in the formation of proliferated structures that host ER, Golgi, and itinerant proteins . GUP1 overexpression enhances ER biogenesis and affects global ER and Golgi structure, leading to the biogenesis of novel membrane arrays with a hybrid Golgi and ER composition .

Tlg1p and its Function in Golgi Transport

Tlg1p, a member of the syntaxin protein family, participates in vesicular transport events within the Golgi apparatus . It is essential for cell viability and plays a role in the transport of proteins through the early Golgi . Depletion of Tlg1p can cause defects in protein transport and morphological changes in the cell .

Maturation-Driven Transport

Early Golgi cisternae form next to the ER, presumably at ERES, and then dissociate from the ER as they mature . Secretory cargo exits the ER in COPII vesicles and becomes concentrated in newly forming early Golgi cisternae .

Rbet1 and its Role in ER-to-Golgi Transport

The mammalian protein rbet1, homologous to yeast Bet1p, is primarily associated with the pre-Golgi intermediate compartment and is involved in vesicular transport from the ER to the Golgi apparatus . Rbet1 may be involved in the docking process of ER-derived vesicles with the cis-Golgi membrane .

p24 Proteins

p24 proteins are not essential for vesicular transport in Saccharomyces cerevisiae . They may serve as quality control factors to restrict the entry of proteins into COPII vesicles .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
GET1; MDM39; YGL020C; Golgi to ER traffic protein 1; Guided entry of tail-anchored proteins 1; Mitochondrial distribution and morphology protein 39
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-235
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
GET1
Target Protein Sequence
MHWAAAVAIFFIVVTKFLQYTNKYHEKWISKFAPGNELSKKYLAKVKERHELKEFNNSIS AQDNYAKWTKNNRKLDSLDKEINNLKDEIQSENKAFQAHLHKLRLLALTVPFFVFKIMYG KTPVYKLSSSTSTLFPTFVSGVWSQGWLYVLLHPLRTISQKWHIMEGKFGASKFDDMALQ SVSLGIWVWALMNVINGVEFIVKQLFLTPKMEAPASVETQEEKALDAVDDAIILD
Uniprot No.

Target Background

Function

GET1 is essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum (ER). In conjunction with GET2, it functions as a membrane receptor for soluble GET3, which specifically recognizes and binds the transmembrane domain of TA proteins in the cytosol. The GET complex collaborates with the HDEL receptor ERD2 to facilitate the ATP-dependent retrieval of ER resident proteins (containing a C-terminal H-D-E-L retention signal) from the Golgi apparatus back to the ER. GET1 also plays a role in mitochondrial distribution and morphology.

Gene References Into Functions
  1. Get1/2 deficiency significantly impairs mitophagy during prolonged respiratory growth, highlighting its role in tail-anchored (TA) protein insertion into the ER membrane. Other autophagy processes showed only minor defects under similar conditions. PMID: 29673596
  2. GET1 and GET2, ER membrane proteins, are crucial for maintaining normal cardiolipin levels. PMID: 26926495
  3. Mutations within the Get1/2 transmembrane domain disrupt TA protein insertion without affecting cytosolic domain function. PMID: 25043001
  4. Mdm39p, potentially involved in ER calcium ion flux regulation, is essential for mutants lacking Spf1p. PMID: 15909163
Database Links

KEGG: sce:YGL020C

STRING: 4932.YGL020C

Protein Families
WRB/GET1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is GET1 and what is its primary function in Saccharomyces cerevisiae?

GET1 is a critical component of the GET pathway in Saccharomyces cerevisiae, forming part of the Get1/2 complex that resides in the endoplasmic reticulum (ER) membrane. This complex functions as an insertase for tail-anchored (TA) proteins, which contain a single C-terminal transmembrane domain. The primary function of Get1/2 is to facilitate the insertion of these TA proteins into the ER membrane after they have been captured by the cytosolic chaperone Get3. Recent research has revealed that the Get1/2 complex forms a hydrophilic channel in the lipid bilayer that mediates both the insertion of transmembrane domains and the translocation of C-terminal hydrophilic segments across the ER membrane .

To study GET1 function, researchers typically employ a combination of genetic approaches (gene deletions, mutations), biochemical assays (protein purification, reconstitution into liposomes), and fluorescence-based assays to monitor protein insertion events. Reconstitution experiments using purified components have been particularly valuable in elucidating the channel-forming properties of the Get1/2 complex .

How does the Get1/2 complex interact with other components of the GET pathway?

The Get1/2 complex functions as a receptor for Get3, which delivers TA proteins to the ER membrane. The interaction between Get3 and Get1/2 is dynamic and regulated: Get3 captures TA proteins in the cytosol and delivers them to the Get1/2 complex. Interestingly, Get3 binding can seal the Get1/2 channel, which dynamically opens and closes in the membrane . This sealing function likely helps maintain the membrane permeability barrier in cells during the protein insertion process.

Methodologically, researchers can investigate these interactions using:

  • Co-immunoprecipitation assays to detect protein-protein interactions

  • Fluorescence resonance energy transfer (FRET) to monitor dynamic interactions

  • In vitro binding assays with purified components

  • Structural studies using X-ray crystallography or cryo-EM to visualize complex formation

What phenotypes are associated with GET1 mutations or deletions in yeast?

Mutations or deletions in GET1 can lead to several observable phenotypes due to defects in TA protein insertion. When designing experiments to study GET1 function through mutation or deletion approaches, researchers should consider:

  • Growth defects under various stress conditions

  • Mislocalization of TA proteins that would normally reside in the ER membrane

  • Accumulation of TA protein aggregates in the cytosol

  • Activation of cellular stress responses, particularly the unfolded protein response

  • Synthetic growth defects when combined with mutations in other protein quality control or insertion pathways

To properly assess these phenotypes, employ a combination of growth assays, fluorescence microscopy to track protein localization, and biochemical fractionation to determine subcellular distribution of TA proteins in wild-type versus mutant strains.

How does the Get1/2 complex form a hydrophilic channel in the lipid bilayer?

The Get1/2 complex forms a hydrophilic channel in the lipid bilayer that facilitates the insertion of TA proteins. Recent research using bulk fluorescence and microfluidics assays has demonstrated that this channel is approximately 2.5 nm wide, corresponding to the circumference of two Get1/2 complexes . The channel dynamically opens and closes, and Get3 binding can seal the channel, likely helping to maintain membrane integrity during protein insertion.

Methodologically, researchers studying channel formation should consider:

  • Proteoliposome reconstitution approaches using purified Get1 and Get2 proteins

  • Channel conductance measurements to assess ion flow through the channel

  • Fluorescence-based assays using NBD-conjugated lipids and membrane-impermeable quenchers like sodium dithionite to detect channel formation

  • Site-directed mutagenesis of specific residues to identify amino acids critical for channel formation and function

Mutagenesis studies have revealed that positively charged amino acids (K150 and K157) in the first transmembrane domain of Get2 contribute to forming the Get1/2 channel . This suggests that these residues may line the channel and facilitate the passage of hydrophilic regions of TA proteins.

What experimental approaches can be used to study Get1/2 channel dynamics?

To investigate the dynamic opening and closing of the Get1/2 channel, researchers can employ several sophisticated experimental approaches:

  • Single-channel electrophysiology: This technique allows direct measurement of channel opening and closing events by monitoring ion conductance across a membrane containing reconstituted Get1/2 complexes.

  • Fluorescence-based assays: As described in recent research, NBD-conjugated lipids in small unilamellar vesicles (SUVs) can be used with membrane-impermeable quenchers like sodium dithionite to monitor channel formation and dynamics .

  • Microfluidics approaches: These allow for controlled delivery of reagents and real-time monitoring of channel activity in reconstituted systems.

  • FRET-based sensors: By strategically placing fluorophores on different regions of Get1 and Get2, researchers can monitor conformational changes associated with channel opening and closing.

  • Hydrogen-deuterium exchange mass spectrometry: This technique can identify regions of Get1/2 that undergo conformational changes during channel operation.

When designing experiments, it's important to consider the reconstitution efficiency and orientation of Get1/2 in liposomes. Research has shown that approximately 18% of Get1 and Get2 may be reversely oriented in SUVs, with the remaining proteins either correctly oriented, uninserted, or stuck on the membrane surface .

How does the Get1/2 channel compare to other membrane protein insertases and translocons?

FeatureGet1/2 ComplexSec61 TransloconCOPI/COPII Vesicle Machinery
SubstratesTail-anchored proteinsSignal sequence-containing proteinsVarious cargo proteins
MechanismForms hydrophilic channel (~2.5 nm)Forms aqueous poreVesicle-mediated transport
Energy requirementGet3 interaction (ATP)Ribosome/SecA (ATP/GTP)GTPases (Sar1, Arf1)
RegulationGet3 seals channelRibosome/SecA interactionCargo recognition by adaptor complexes
DirectionalityCytosol to ER membraneCytosol to ER lumen/membraneBidirectional between ER-Golgi

When studying the Get1/2 channel, researchers should consider experimental designs that can distinguish its unique properties from other insertion/translocation pathways. This might include reconstitution of different machinery in liposomes and comparing their functional properties, or developing assays that specifically measure TA protein insertion as opposed to other types of membrane or secretory proteins.

What role does GET1 play in protein quality control at the ER-Golgi interface?

The role of GET1 in protein quality control extends beyond its function in TA protein insertion. At the ER-Golgi interface, various mechanisms exist for protein sorting and retrieval of misfolded proteins. While GET1 is primarily involved in TA protein insertion at the ER, understanding its potential role in quality control requires considering the broader context of ER-Golgi protein trafficking.

Research approaches to investigate this function include:

  • Analyzing interactions between GET1 and other quality control machinery: Co-immunoprecipitation and proximity labeling approaches can identify potential interactions between GET1 and components of ER quality control pathways.

  • Assessing the fate of misfolded TA proteins: Tracking the localization and degradation of model misfolded TA proteins in wild-type versus GET1 mutant cells can reveal quality control functions.

  • Investigating potential relationships with ER retrieval receptors: Proteins like Rer1 mediate Golgi-ER retrieval of membrane proteins lacking traditional retrieval signals . Determining whether GET1 works with these systems could reveal broader roles in quality control.

The interplay between protein folding, ER export signals, and retrieval mechanisms is complex. Notably, functional ER export signals can coexist with ERAD and retention signals, with forward traffic under dynamic control of multiple competing interactions . Understanding how GET1 fits into this network requires careful experimental design that can distinguish direct effects from indirect consequences of disrupted TA protein insertion.

How can I optimize reconstitution of the Get1/2 complex for in vitro studies?

Successful reconstitution of the Get1/2 complex into liposomes is critical for in vitro studies of channel formation and function. Based on published methodologies, consider the following optimization steps:

  • Protein purification: Express recombinant Get1 and Get2 proteins with appropriate tags for purification. Ensure high purity and proper folding before reconstitution .

  • Lipid composition: The composition of the lipid bilayer can significantly affect protein insertion and function. Test different lipid mixtures that mimic the ER membrane composition.

  • Protein-to-lipid ratio: Optimize the ratio of Get1/2 proteins to lipids to achieve efficient incorporation without aggregation.

  • Reconstitution method: Several methods exist for protein reconstitution into liposomes, including detergent-mediated reconstitution and direct incorporation during liposome formation. Compare different methods to identify the optimal approach for the Get1/2 complex.

  • Quality control: Assess the orientation and functionality of reconstituted Get1/2 complexes using protease protection assays and functional tests . As noted in previous research, only a fraction of the reconstituted proteins may adopt the correct orientation, so developing methods to enrich for properly oriented complexes is important.

  • Stability optimization: Determine conditions (buffer composition, temperature, etc.) that maximize the stability and activity of the reconstituted complex.

A typical reconstitution protocol might involve purification of Get1 and Get2 proteins, preparation of liposomes with an appropriate lipid composition, detergent-mediated incorporation of the proteins into the liposomes, and removal of detergent by dialysis or biobeads. The resulting proteoliposomes can then be characterized using a combination of biochemical and biophysical approaches to ensure proper reconstitution.

What are the best methods for expressing and purifying recombinant GET1 for structural and functional studies?

For successful expression and purification of recombinant GET1, consider the following methodological approaches:

  • Expression systems:

    • E. coli: While convenient, may not provide proper folding for membrane proteins

    • S. cerevisiae: Native environment ensures proper folding and post-translational modifications

    • Pichia pastoris: High expression levels for membrane proteins

    • Insect cells: Good for complex eukaryotic proteins that require specific folding environments

  • Construct design:

    • Include affinity tags (His, FLAG, etc.) for purification

    • Consider fusion partners to enhance solubility

    • Design constructs with and without predicted transmembrane domains for different applications

    • For structural studies, remove flexible regions that may impede crystallization

  • Solubilization and purification:

    • Test different detergents (DDM, LMNG, etc.) for efficient solubilization

    • Employ affinity chromatography followed by size exclusion chromatography

    • Consider lipid addition during purification to stabilize the protein

  • Quality assessment:

    • Size exclusion chromatography to check for aggregation

    • Negative stain EM to assess homogeneity

    • Functional assays to confirm activity post-purification

When designing experiments with purified GET1, ensure that the purification method preserves the native structure and function of the protein. For co-purification of the Get1/2 complex, co-expression of both proteins followed by tandem affinity purification may yield better results than reconstituting the complex from individually purified proteins.

How can I design experiments to investigate the role of specific amino acids in Get1/2 channel formation?

To investigate the role of specific amino acids in Get1/2 channel formation, a systematic mutagenesis approach combined with functional assays is recommended:

  • Identification of candidate residues:

    • Analyze sequence conservation across species

    • Examine predicted transmembrane regions for charged or polar residues

    • Use structural information (if available) to identify residues lining the putative channel

    • Consider positively charged residues such as K150 and K157 in Get2, which have been implicated in channel formation

  • Mutagenesis strategy:

    • Alanine scanning: Replace selected residues with alanine to remove side chain functionality

    • Charge reversal: Change positive to negative charges or vice versa

    • Conservative substitutions: Maintain similar properties but alter size or hydrogen bonding potential

    • Create chimeric proteins with related channels to identify domain-specific functions

  • Functional assays:

    • Channel conductance measurements in reconstituted systems

    • Fluorescence-based assays with NBD-conjugated lipids and sodium dithionite to assess channel permeability

    • TA protein insertion assays to correlate channel activity with insertion efficiency

    • In vivo complementation studies in GET1/GET2 deletion strains

  • Data analysis and interpretation:

    • Correlate structural changes with functional outcomes

    • Consider both direct effects on channel formation and indirect effects on Get3 interaction

    • Use statistical analysis to identify significant differences between mutants

What techniques can be used to visualize Get1/2-mediated TA protein insertion in real-time?

Visualizing Get1/2-mediated TA protein insertion in real-time requires sophisticated imaging techniques and clever experimental design:

  • Fluorescence-based approaches:

    • FRET pairs on the TA protein and the Get1/2 complex to monitor interaction and insertion

    • Environment-sensitive fluorophores that change intensity or wavelength upon membrane insertion

    • Single-molecule TIRF microscopy to visualize individual insertion events

    • Stopped-flow fluorescence to capture rapid kinetics of insertion

  • Microfluidics platforms:

    • Combine with fluorescence imaging for controlled delivery of components

    • Allow for rapid solution exchange to initiate insertion events

    • Enable real-time monitoring of multiple parameters simultaneously

  • Novel reporter systems:

    • Split fluorescent proteins where one part is attached to Get1/2 and the other to the TA protein

    • Self-quenching fluorophores on TA proteins that become fluorescent upon insertion

    • pH-sensitive fluorophores that report on the environment change during insertion

  • Combinations with structural techniques:

    • Time-resolved cryo-EM to capture different states of the insertion process

    • Mass photometry to monitor complex formation and dissociation in real-time

When designing real-time visualization experiments, consider the temporal resolution needed to capture relevant events. TA protein insertion may occur on a millisecond-to-second timescale, requiring appropriate instrumentation for detection. Additionally, ensure that the fluorescent labels or other modifications do not significantly alter the insertion process itself.

How can I analyze contradictory data regarding GET1 function in different experimental systems?

When faced with contradictory data regarding GET1 function across different experimental systems, consider the following analytical approach:

  • Systematic comparison of experimental conditions:

    • Create a detailed table comparing key parameters across studies:

    ParameterStudy AStudy BStudy C
    Expression systemS. cerevisiaeE. coliP. pastoris
    Protein constructsFull-lengthTruncatedTagged
    Membrane environmentNative ERLiposomesNanodiscs
    Detection methodFluorescenceWestern blotMass spec
    Substrate proteinsNative TAsModel TAsChimeric TAs
  • Evaluate methodological differences:

    • Assess how differences in reconstitution methods might affect Get1/2 channel properties

    • Consider the impact of protein orientation in reconstituted systems (~18% reverse orientation reported in some systems)

    • Analyze differences in substrate proteins used across studies

  • Contextual dependencies:

    • Determine if GET1 function varies depending on cellular context or experimental conditions

    • Consider potential interactions with other cellular components that may be present in some systems but not others

    • Evaluate the role of post-translational modifications that may occur differentially across systems

  • Reconciliation strategies:

    • Design experiments that directly test hypotheses explaining the contradictions

    • Perform experiments in multiple systems in parallel under identical conditions

    • Collaborate with groups reporting contradictory results to identify sources of variation

When interpreting contradictory data, avoid the assumption that one dataset is "correct" and others are "wrong." Instead, focus on identifying the specific conditions under which different results are obtained, as this may reveal important insights about context-dependent functions of GET1.

What statistical approaches are most appropriate for analyzing Get1/2 channel activity data?

When designing experiments to generate channel activity data, incorporate proper controls and replication to enable robust statistical analysis. Consider power analysis to determine appropriate sample sizes, and pre-register analysis plans when possible to avoid post-hoc bias in analysis choices.

What are the emerging technologies that could advance our understanding of GET1 function?

Several cutting-edge technologies are poised to transform our understanding of GET1 function:

  • Cryo-electron microscopy (Cryo-EM):

    • Near-atomic resolution structures of the Get1/2 complex in different functional states

    • Visualization of the Get1/2 channel in open and closed conformations

    • Structures of Get1/2 in complex with Get3 and TA protein substrates

  • Advanced fluorescence techniques:

    • Super-resolution microscopy to visualize Get1/2 distribution and clustering in the ER membrane

    • Single-molecule tracking to monitor Get1/2 dynamics in live cells

    • Fluorescence correlation spectroscopy to measure interaction kinetics

  • Computational approaches:

    • Molecular dynamics simulations of the Get1/2 channel to predict conformational changes

    • Deep learning algorithms to predict TA protein targeting based on sequence features

    • Systems biology models integrating GET pathway function with other cellular processes

  • Genome engineering technologies:

    • CRISPR-Cas9 for precise modification of GET1 in various model systems

    • Base editing for introducing specific point mutations without double-strand breaks

    • CRISPRi/CRISPRa for temporal control of GET1 expression

  • Proteomic approaches:

    • Proximity labeling techniques (BioID, APEX) to identify novel GET1 interactors

    • Crosslinking mass spectrometry to map interaction interfaces

    • Thermal proteome profiling to assess effects of GET1 perturbation on the proteome

When designing future research programs, consider integrating multiple technologies to address complementary aspects of GET1 function. For example, combining structural studies with functional assays and computational predictions can provide a more comprehensive understanding than any single approach alone.

How does understanding GET1 function contribute to broader questions in membrane protein biogenesis?

Research on GET1 and the Get1/2 complex contributes significantly to our understanding of fundamental questions in membrane protein biogenesis:

  • Mechanisms of membrane protein insertion:

    • The Get1/2 complex represents a distinct insertion mechanism compared to the Sec61 translocon

    • Understanding Get1/2 channel formation provides insights into how hydrophilic channels can mediate the insertion of hydrophobic transmembrane domains

    • The dual function of Get1/2 as both an insertase for TMDs and a translocase for hydrophilic segments raises questions about the evolutionary relationships between different insertion machineries

  • Quality control in membrane protein biogenesis:

    • GET1 function intersects with broader questions about how cells distinguish between properly folded and misfolded membrane proteins

    • The interplay between GET pathway components and ER quality control machinery illuminates how cells handle the complex challenge of membrane protein folding

    • Understanding retrieval mechanisms for misfolded membrane proteins at the ER-Golgi interface complements our knowledge of insertion mechanisms

  • Evolutionary perspectives:

    • Conservation of GET pathway components across eukaryotes suggests fundamental importance

    • Comparison with bacterial insertion pathways provides insights into the evolution of membrane protein biogenesis

    • Specialization of insertion pathways for different substrate classes raises questions about the advantages of pathway diversification

  • Integration with cellular physiology:

    • GET pathway function affects the biogenesis of many critical membrane proteins

    • Understanding how cells regulate GET1 expression and function may reveal mechanisms for adapting to changing cellular needs

    • The consequences of GET pathway dysfunction for cellular health connect to broader questions about protein homeostasis

Future research on GET1 should consider these broader questions, designing experiments that not only elucidate specific aspects of GET1 function but also contribute to our understanding of membrane protein biogenesis as a whole.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.