Recombinant Saccharomyces cerevisiae Golgi to ER traffic protein 2 (GET2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GET2; HUR2; RMD7; SCY_1586; Golgi to ER traffic protein 2; Hydroxyurea resistance protein 2; Required for meiotic nuclear division protein 7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-285
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain YJM789) (Baker's yeast)
Target Names
GET2
Target Protein Sequence
MSELTEAEKRRLLRERRQKKFSNGGASSRLNKITGQASSHLNAESPLDAPSAAKATPPAS VHSATPDIKEDSNVAPQLDLLKQLAAMQGQGTGKSTPQDSSTPDLLSLLSSMNTGMPSAE GTPSFGQAAPAAPINQAALDYHDYLLNRLKAWTILVKWVFFLLPYLYLITRPNSSVWPAY AFTQSAWFAPLRNPSNFTRIFATFEFLSISIYYQLLKNVEHKSKIKNLQDTNKLVKLVSL VPEGVIPVANLKGKLITLLQYWDLLSMLITDISFVLIVLGLLTYL
Uniprot No.

Target Background

Function

GET2 is essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum (ER). It functions as a membrane receptor, in conjunction with GET1, for soluble GET3. GET3 recognizes and binds the transmembrane domain of TA proteins within the cytosol. The GET complex collaborates with the HDEL receptor ERD2 to facilitate ATP-dependent retrieval of ER resident proteins containing a C-terminal H-D-E-L retention signal from the Golgi apparatus to the ER. GET2 also plays roles in DNA replication, DNA damage response, and cell wall function.

Protein Families
GET2 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the biological significance of Golgi to ER trafficking in Saccharomyces cerevisiae?

Retrograde transport from the Golgi to the ER is essential for cellular homeostasis in Saccharomyces cerevisiae. This process ensures the retrieval of ER-resident proteins that have escaped to the Golgi and facilitates the recycling of proteins that cycle between these compartments. The interdependence of anterograde (ER-to-Golgi) and retrograde (Golgi-to-ER) vesicle trafficking creates a balanced system that maintains proper cellular function. Disruption of this retrograde pathway can lead to ER stress, misfolding of proteins, and ultimately impaired cellular functions. Research has demonstrated that retrograde transport is not merely a salvage pathway but plays critical roles in maintaining the composition of both the ER and Golgi compartments, which is essential for proper protein maturation, quality control, and secretion .

How does the GET pathway differ from other retrograde trafficking mechanisms?

The GET (Guided Entry of Tail-anchored proteins) pathway represents a specialized mechanism for the insertion of tail-anchored proteins into the ER membrane, which differs from the COPI-mediated retrograde transport system. While COPI vesicles primarily mediate the bulk retrieval of soluble and membrane proteins from the Golgi to the ER using signals like the HDEL/KDEL retrieval sequence, the GET pathway specifically facilitates the post-translational insertion of tail-anchored proteins with C-terminal transmembrane domains.

The GET system components work together as a molecular chaperone network: GET2 functions as a membrane receptor at the ER, typically working in concert with GET1 to form a transmembrane complex that receives tail-anchored proteins from the cytosolic GET3 ATPase. This system ensures proper targeting and insertion of these specialized proteins, which would otherwise be prone to aggregation due to their hydrophobic transmembrane domains. Unlike COPI-mediated transport, which involves vesicle formation and fusion, the GET pathway represents a direct targeting mechanism for a specific class of proteins .

What are the key components involved in yeast retrograde trafficking?

Retrograde trafficking in Saccharomyces cerevisiae involves several key components:

ComponentTypeFunction
Coatomer (COPI)Protein complexForms the coat of retrograde transport vesicles
Arf1pSmall GTPaseRegulates COPI vesicle formation
Gcs1p/Glo3pARF-GAPsActivate GTPase activity of Arf1p
Erd2pReceptorHDEL receptor that recognizes retrieval signals
v-SNAREs (e.g., Sec22p)Membrane proteinsMediate vesicle fusion with target membranes
t-SNAREsMembrane proteinsProvide specificity for vesicle targeting
Sec18p (NSF homolog)ATPaseDisassembles SNARE complexes
Lma1p complexProtein complexRequired for vesicle fusion

In vitro reconstitution experiments have demonstrated that a relatively simple set of purified cytosolic proteins, including Sec18p, the Lma1p complex, Uso1p, coatomer, and Arf1p, is sufficient to support a full cycle of anterograde and retrograde transport. Among the membrane-bound v-SNARE proteins, Sec22p appears to be specifically required for retrograde trafficking, while Bet1p functions in both directions of transport .

How can we effectively distinguish between GET pathway defects and general retrograde trafficking impairments?

Distinguishing between GET pathway-specific defects and general retrograde trafficking impairments requires a multi-faceted experimental approach:

  • Marker protein trafficking assays: Compare the trafficking of GET-dependent tail-anchored proteins with COPI-dependent recycling proteins. For GET pathway-specific defects, only tail-anchored proteins would show localization defects, while general HDEL/KDEL-containing proteins would be properly retrieved to the ER.

  • Genetic interaction analysis: Perform synthetic genetic array (SGA) analysis with known GET pathway components versus COPI components. GET pathway-specific defects will show strong genetic interactions with other GET mutations but not with COPI mutations.

  • Biochemical reconstitution: Use in vitro reconstitution assays similar to those described for general retrograde transport, but with purified GET pathway components. Successful reconstitution of GET-mediated insertion independent of COPI function would provide strong evidence for pathway separation.

  • Membrane expansion phenotypes: Examine the ER membrane morphology using fluorescence microscopy with ER markers. GET pathway defects often lead to distinct patterns of ER membrane expansion compared to COPI defects, which can be quantified by measuring membrane surface area and distribution patterns .

  • Cargo-specific stress responses: Monitor the induction of specific stress response pathways. GET pathway defects typically trigger cytosolic protein quality control responses, while general retrograde trafficking defects more commonly induce the unfolded protein response (UPR) in the ER lumen .

What are the methodological approaches for studying GET2 interactions with other GET pathway components?

Studying GET2 interactions with other GET pathway components requires a combination of biochemical, genetic, and imaging approaches:

Biochemical Approaches:

  • Co-immunoprecipitation (Co-IP): Use epitope-tagged GET2 to pull down associated proteins, followed by mass spectrometry to identify interacting partners. This can be performed under different conditions (e.g., ATP depletion, GET3 overexpression) to capture condition-dependent interactions.

  • In vitro binding assays: Purify recombinant GET pathway components and assess direct binding through techniques such as surface plasmon resonance (SPR) or microscale thermophoresis (MST) to measure binding affinities and kinetics.

  • Crosslinking mass spectrometry: Use chemical crosslinkers to capture transient interactions, followed by mass spectrometry analysis to identify not only binding partners but also specific interaction domains.

Genetic Approaches:

  • Yeast two-hybrid screening: Use GET2 as bait to screen for interacting proteins, with specific focus on interactions with other GET pathway components.

  • Suppressor screening: Identify genetic suppressors of GET2 mutations to reveal functional relationships.

  • Epistasis analysis: Determine the order of function within the pathway by analyzing double mutants.

Imaging Approaches:

  • Bimolecular fluorescence complementation (BiFC): Visualize protein interactions in live cells by tagging potential interacting partners with complementary fragments of fluorescent proteins.

  • Förster resonance energy transfer (FRET): Measure protein-protein proximities in living cells by tagging GET2 and potential partners with appropriate fluorophore pairs.

These methodological approaches provide complementary information about the physical, functional, and spatial relationships between GET2 and other components of the GET pathway .

How does the stoichiometry of GET2 affect the efficiency of tail-anchored protein insertion?

The stoichiometry of GET2 and its relationship to GET pathway efficiency represents a critical aspect of understanding the mechanism of tail-anchored protein insertion. Research approaches to address this question include:

  • Controlled expression systems: Using promoters of varying strengths to create a series of strains with different levels of GET2 expression. Measure the correlation between GET2 protein levels and insertion efficiency of model tail-anchored proteins.

  • Single-molecule imaging: Apply techniques such as stepwise photobleaching analysis or single-molecule pull-down assays to determine the native stoichiometry of GET2 within the insertion complex at the ER membrane.

  • Quantitative mass spectrometry: Use SILAC (Stable Isotope Labeling with Amino acids in Cell culture) or TMT (Tandem Mass Tag) approaches to quantify the relative abundance of GET pathway components across different conditions and correlate with pathway functionality.

  • In vitro reconstitution assays: Systematically vary the concentration of GET2 in proteoliposomes to establish a dose-response relationship for tail-anchored protein insertion efficiency. This approach allows direct measurement of insertion kinetics as a function of GET2 concentration.

  • Mathematical modeling: Develop kinetic models of the GET pathway that incorporate stoichiometric parameters, which can be refined through experimental testing to predict the optimal stoichiometry for efficient insertion.

Research has suggested that the GET1/GET2 receptor complex stoichiometry is tightly regulated, and both under- and overexpression can negatively impact insertion efficiency, similar to the balance required in anterograde and retrograde trafficking systems .

How can we establish an in vitro system to study GET2-mediated tail-anchored protein insertion?

Establishing an in vitro system for studying GET2-mediated tail-anchored protein insertion requires careful experimental design, similar to the successful reconstitution of retrograde transport from the Golgi to the ER. The following methodological approach can be implemented:

  • Component preparation:

    • Express and purify recombinant GET pathway components (GET1, GET2, GET3, and tail-anchored protein substrates)

    • Prepare ER-derived microsomes or synthetic liposomes with appropriate lipid composition

    • Label tail-anchored protein substrates with fluorophores or radioisotopes for detection

  • Assay setup:

    • Reconstitute purified GET1 and GET2 into proteoliposomes at controlled ratios

    • Pre-form GET3-tail-anchored protein complexes in the presence of ATP

    • Mix the GET3-substrate complex with GET1/GET2 proteoliposomes

    • Include appropriate controls: liposomes without GET1/GET2, ATPase-deficient GET3 mutants

  • Analysis methods:

    • Protease protection assays to verify membrane insertion (properly inserted tail-anchored proteins will be protected from externally added proteases)

    • Flotation assays to separate membrane-associated from soluble proteins

    • FRET-based real-time monitoring of insertion kinetics

    • Crosslinking to capture transient intermediates

  • Validation approaches:

    • Compare results with known GET pathway mutants

    • Correlate in vitro findings with in vivo phenotypes

    • Use structural biology techniques (cryo-EM, X-ray crystallography) to validate intermediates

This in vitro system would allow for mechanistic studies of GET2 function, including the effects of mutations, the role of specific domains, and the kinetics of tail-anchored protein insertion. The design principles are informed by successful reconstitution of other membrane trafficking processes in yeast, such as the retrograde transport assay that measures the retrieval of HDEL-tagged proteins .

What approaches can be used to quantify the impact of GET2 mutations on protein trafficking?

Quantifying the impact of GET2 mutations on protein trafficking requires a comprehensive experimental approach that combines in vivo and in vitro methods:

In vivo approaches:

  • Reporter protein localization: Express fluorescently-tagged tail-anchored proteins in strains harboring different GET2 mutations. Quantify mislocalization using high-content fluorescence microscopy and automated image analysis to determine the percentage of properly localized reporter protein.

  • Pulse-chase analysis: Use radioisotope labeling or inducible expression systems to follow the fate of newly synthesized tail-anchored proteins over time. This allows determination of insertion kinetics and efficiency in different GET2 mutant backgrounds.

  • Growth phenotype assays: Develop a panel of growth conditions that are sensitive to GET pathway defects (e.g., ER stress-inducing agents) and quantify growth rates of strains with different GET2 mutations.

  • Proteomics analysis: Use SILAC or TMT-based quantitative proteomics to measure the global impact of GET2 mutations on the membrane proteome, focusing on known tail-anchored proteins.

In vitro approaches:

  • Reconstituted insertion assays: Purify the mutant GET2 proteins and measure their ability to form functional complexes with GET1 and to facilitate insertion of tail-anchored proteins in reconstituted proteoliposomes.

  • Binding affinity measurements: Use biophysical techniques (isothermal titration calorimetry, surface plasmon resonance) to quantify how mutations affect the interaction between GET2 and other components of the pathway.

  • Structural analysis: Determine structural changes induced by mutations using techniques such as hydrogen-deuterium exchange mass spectrometry (HDX-MS) or limited proteolysis.

Data from these complementary approaches can be integrated to create a comprehensive quantitative profile of each GET2 mutation, correlating structural changes with functional impacts on protein trafficking efficiency .

How can we develop a high-throughput screening system to identify modulators of GET pathway function?

Developing a high-throughput screening system for modulators of the GET pathway requires design of assays that provide clear, quantifiable readouts of pathway function:

  • Yeast growth-based screens:

    • Create a synthetic genetic system where yeast survival depends on functional GET pathway (e.g., essential tail-anchored protein under control of regulated promoter)

    • Implement in 384 or 1536-well format with automated liquid handling

    • Screen compound libraries or genetic perturbations (overexpression, CRISPR libraries)

    • Use colony size or growth rate as primary readout

  • Fluorescent reporter systems:

    • Design split fluorescent protein systems where one half is fused to a tail-anchored protein

    • Proper membrane insertion brings the fragments together, resulting in fluorescence

    • Measure fluorescence intensity in high-throughput format

    • Can be adapted for flow cytometry-based sorting of genetic libraries

  • Stress response reporters:

    • Utilize GET pathway disruption-induced stress responses

    • Create reporter strains with stress-responsive elements driving fluorescent protein expression

    • Screen for compounds or genetic factors that modulate reporter activation

  • Automated microscopy screens:

    • Express fluorescently-tagged GET pathway components and tail-anchored protein substrates

    • Develop image analysis pipelines to quantify localization, aggregation, or co-localization

    • Implement in high-content screening platforms with automated image acquisition and analysis

  • Biochemical screen adaptation:

    • Develop a simplified biochemical assay based on the in vitro reconstitution system

    • Adapt to fluorescence polarization, FRET, or AlphaScreen format

    • Miniaturize to 384 or 1536-well format for compound screening

Each screening approach should include appropriate controls, counter-screens to eliminate false positives, and secondary assays to validate hits. The system can be calibrated using known GET pathway mutants with varying degrees of functional impairment .

How should researchers interpret conflicting data regarding GET2 function across different experimental systems?

Interpreting conflicting data regarding GET2 function across different experimental systems requires a systematic analytical approach:

  • Methodological comparison analysis:

    • Create a comprehensive table comparing experimental conditions across studies (yeast strains, expression systems, assay conditions)

    • Identify critical variables that differ between studies (temperature, media composition, expression levels)

    • Reproduce key experiments with standardized conditions to directly test the impact of these variables

  • Contextual dependency framework:

    • Consider that GET2 may have context-dependent functions that are differentially revealed in various experimental systems

    • Design experiments to directly test contextual dependencies (e.g., stress conditions, genetic background effects)

    • Develop integrative models that incorporate context-dependent functionality

  • Quantitative reconciliation approach:

    • Apply statistical meta-analysis techniques to quantitatively compare results across studies

    • Use Bayesian approaches to update confidence in specific models as new data becomes available

    • Develop probabilistic models that can accommodate apparently conflicting observations

  • Collaborative resolution strategy:

    • Establish collaborations between labs with conflicting results to directly compare methodologies

    • Implement blinded experimental designs to minimize bias

    • Conduct parallel experiments with sample sharing to identify sources of variation

  • Functional domain analysis:

    • Map conflicting results to specific functional domains of GET2

    • Consider that different assays may be more sensitive to distinct aspects of GET2 function

    • Design domain-specific assays to resolve apparent conflicts

When analyzing conflicting data, it is important to consider that the GET pathway interacts with other cellular systems, and differences in experimental conditions may reveal different aspects of these interactions. The interdependence of anterograde and retrograde trafficking pathways means that experimental perturbations may have complex, system-wide effects that can be difficult to interpret in isolation .

What statistical approaches are most appropriate for analyzing GET2 trafficking kinetics data?

Analyzing GET2 trafficking kinetics data requires sophisticated statistical approaches tailored to the temporal and often noisy nature of trafficking data:

  • Kinetic model fitting:

    • Apply ordinary differential equation (ODE) models to fit time-course data

    • Use maximum likelihood estimation or Bayesian parameter estimation

    • Compare different kinetic models (first-order, cooperative, competitive) using Akaike Information Criterion (AIC) or Bayesian Information Criterion (BIC)

    • Example model parameters might include:

ParameterDescriptionTypical Units
k_insertionRate constant for TA protein insertionmin^-1
K_mAffinity of GET3-TA complex for GET1/2nM
n_HillCooperativity coefficientdimensionless
t_1/2Half-time for insertionmin
  • Time series analysis:

    • Implement autocorrelation analysis to identify temporal patterns

    • Use dynamic time warping for comparing trafficking kinetics between different conditions

    • Apply changepoint detection to identify significant shifts in trafficking rates

  • Mixed-effects modeling:

    • Account for both fixed effects (experimental treatments) and random effects (cell-to-cell variability, experimental batches)

    • Particularly valuable for analyzing single-cell trafficking data

    • Allows proper handling of repeated measures and nested experimental designs

  • Non-parametric approaches:

    • Use Kaplan-Meier estimators for analyzing time-to-event data (e.g., time until a protein reaches its destination)

    • Implement bootstrap resampling to generate confidence intervals without assuming specific distributions

    • Apply permutation tests for comparing kinetic curves between experimental conditions

  • Bayesian data analysis:

    • Incorporate prior knowledge about GET pathway kinetics

    • Generate posterior probability distributions for kinetic parameters

    • Allow for uncertainty quantification and hypothesis testing within a single framework

The appropriate statistical approach depends on the specific experimental design and the nature of the data collected. For pulse-chase experiments, first-order kinetic models may be sufficient, while live-cell imaging data may require more complex spatiotemporal statistical methods .

How can researchers integrate data from multiple experimental approaches to build comprehensive models of GET pathway function?

Integrating diverse experimental data to build comprehensive models of GET pathway function requires a systematic approach:

  • Multi-scale data integration framework:

    • Develop a structured database to organize data across experimental scales (molecular, cellular, organismal)

    • Implement standardized metadata annotation to facilitate cross-study comparisons

    • Design data visualization tools that can simultaneously display multiple data types

  • Bayesian network modeling:

    • Construct probabilistic graphical models representing causal relationships in the GET pathway

    • Use experimental data to learn conditional probabilities between variables

    • Update network structure and parameters as new data becomes available

    • Example network structure might include:

      • GET2 expression level → GET1/GET2 complex formation → Insertion capacity

      • ER stress → GET pathway component expression → Insertion efficiency

  • Multi-omics integration:

    • Combine transcriptomic, proteomic, and phenotypic data using methods such as:

      • Canonical correlation analysis to identify relationships between data types

      • Non-negative matrix factorization to discover latent patterns across datasets

      • Network-based approaches that map different data types to a common interaction network

  • Mechanistic modeling with uncertainty quantification:

    • Develop ordinary differential equation (ODE) models of GET pathway dynamics

    • Constrain model parameters using direct experimental measurements

    • Perform sensitivity analysis to identify key parameters and processes

    • Use ensemble modeling approaches to represent uncertainty in model structure and parameters

  • In silico hypothesis generation and testing:

    • Use computational models to generate testable predictions

    • Design focused experiments to test model predictions

    • Iterate between model refinement and experimental validation

This integrative approach allows researchers to synthesize insights from diverse experimental techniques, including biochemical assays, genetic screens, structural studies, and cell biological observations. The resulting comprehensive models can reveal emergent properties of the GET pathway that might not be apparent from any single experimental approach, similar to how the study of retrograde transport benefited from combining in vitro reconstitution with genetic analyses .

How does the GET pathway interact with other protein quality control systems in Saccharomyces cerevisiae?

The interaction between the GET pathway and other protein quality control systems represents an important frontier in understanding cellular proteostasis networks:

  • Integrated stress response connections:

    • Investigation of how GET pathway defects trigger specific branches of the unfolded protein response (UPR)

    • Analysis of transcriptional and translational changes in response to GET pathway impairment

    • Examination of how the GET pathway interfaces with cytosolic protein quality control systems

  • Ubiquitin-proteasome system interactions:

    • Identification of E3 ubiquitin ligases that target mislocalized tail-anchored proteins

    • Characterization of degradation pathways for GET pathway components

    • Investigation of how protein quality control is balanced with insertion efficiency

  • Autophagy connections:

    • Analysis of selective autophagy mechanisms that may target aggregated tail-anchored proteins

    • Examination of how GET pathway function affects autophagosome formation

    • Investigation of potential roles for tail-anchored proteins in autophagy regulation

  • Chaperone network integration:

    • Mapping interactions between the GET pathway and cytosolic chaperones (Hsp70, Hsp90)

    • Identification of chaperones that may provide alternative insertion pathways

    • Investigation of co-chaperones that might modulate GET pathway function

Research has demonstrated that engineering of both anterograde and retrograde trafficking pathways affects protein secretion and cellular stress responses in yeast. This suggests that the GET pathway likely functions within a broader network of protein quality control systems that collectively maintain proteostasis. Methodological approaches such as genetic interaction mapping and quantitative proteomics are particularly valuable for elucidating these interconnections .

What role might GET2 play in cellular adaptation to stress conditions?

The potential role of GET2 in cellular stress adaptation represents an emerging area of research with significant implications for understanding yeast physiology:

  • Transcriptional and translational regulation:

    • Analysis of GET2 expression changes under various stress conditions (oxidative stress, ER stress, nutrient limitation)

    • Investigation of post-transcriptional regulation mechanisms that may modulate GET2 levels

    • Examination of how GET2 expression correlates with cellular stress responses

  • Functional adaptations:

    • Characterization of potential stress-induced modifications of GET2 protein (phosphorylation, ubiquitination)

    • Investigation of how stress conditions affect GET2 localization and complex formation

    • Analysis of whether GET2 function is altered under specific stress conditions

  • Stress-specific tail-anchored protein requirements:

    • Identification of stress-responsive tail-anchored proteins that may depend on GET2

    • Investigation of whether certain stress conditions increase demand for GET pathway function

    • Analysis of how GET2 function affects stress signaling pathways

  • Evolutionary perspective:

    • Comparative analysis of GET2 function across yeast species with different stress tolerances

    • Examination of GET2 sequence conservation in relation to ecological niches

    • Investigation of how GET pathway function relates to the "make-accumulate-consume" lifestyle of S. cerevisiae

Studies have shown that S. cerevisiae's unique lifestyle, including its ability to produce and tolerate ethanol, has shaped its cellular physiology and gene regulation. The GET pathway may play a role in maintaining membrane protein homeostasis under the stress conditions associated with this lifestyle. Engineering of trafficking pathways has been shown to affect protein secretion and membrane organization, suggesting potential connections between GET2 function and cellular stress responses .

How can advanced imaging techniques enhance our understanding of GET2 dynamics in living cells?

Advanced imaging techniques offer powerful approaches for understanding GET2 dynamics in living cells:

  • Super-resolution microscopy applications:

    • Implement PALM/STORM imaging to resolve GET2 distribution at the ER membrane with 10-20 nm resolution

    • Use structured illumination microscopy (SIM) to visualize the spatial relationship between GET2 and other ER membrane proteins

    • Apply expansion microscopy to physically enlarge samples for improved visualization of GET complexes

  • Single-molecule tracking approaches:

    • Employ photoactivatable fluorescent proteins fused to GET2 for sparse labeling and tracking

    • Analyze diffusion characteristics to distinguish between free and complex-bound GET2

    • Determine residence times at sites of tail-anchored protein insertion

  • Fluorescence fluctuation spectroscopy:

    • Implement fluorescence correlation spectroscopy (FCS) to measure GET2 diffusion and concentration

    • Use photon counting histogram (PCH) analysis to determine GET2 oligomerization state

    • Apply number and brightness (N&B) analysis to map GET2 complex formation across the ER

  • FRET-based interaction mapping:

    • Develop FRET sensors to monitor GET2-GET1 interactions in real time

    • Apply fluorescence lifetime imaging microscopy (FLIM) for quantitative measurements of protein interactions

    • Implement multiplexed FRET imaging to simultaneously track multiple GET pathway components

  • Correlative light and electron microscopy (CLEM):

    • Combine fluorescence imaging of GET2 with electron microscopy of membrane ultrastructure

    • Use cryo-CLEM to visualize GET pathway components in a near-native state

    • Apply APEX2 proximity labeling to identify proteins in the vicinity of GET2 at the ultrastructural level

These advanced imaging approaches can reveal the dynamic behavior of GET2 in its native cellular context, providing insights that complement biochemical and genetic studies. Similar imaging approaches have been valuable for understanding other membrane trafficking processes, such as the dynamics of COPI vesicle formation and fusion .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.