Recombinant Saccharomyces cerevisiae GPI transamidase component GAA1 (GAA1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Saccharomyces cerevisiae GPI Transamidase Component GAA1 (GAA1)

The GPI transamidase component GAA1 is a conserved protein critical for glycosylphosphatidylinositol (GPI) anchor attachment to proteins in eukaryotic cells. In Saccharomyces cerevisiae, GAA1 (also known as END2 or YLR088W) forms a complex with Gpi8p and Gpi16p to catalyze the transamidation reaction that replaces the GPI attachment signal peptide with a preassembled GPI lipid . Recombinant GAA1 refers to engineered versions of this protein produced in heterologous systems (e.g., E. coli, yeast, or mammalian cells) for biochemical and structural studies .

Role in GPI Transamidase Activity

  • Carbonyl Intermediate Formation: GAA1 knockout in S. cerevisiae or mammalian cells abolishes carbonyl intermediate formation, leading to GPI attachment failure .

  • Catalytic Coordination: GAA1’s zinc-binding site (coordinated by conserved polar residues) is critical for catalysis, as suggested by sequence analysis .

Interactions with Other Transamidase Components

  • Gpi8p: Forms a stable complex with GAA1; depletion of either destabilizes the other .

  • Gpi16p: Stabilizes the transamidase complex and facilitates GPI lipid binding .

Applications in Research

  • Biochemical Assays: Recombinant GAA1 is used to study transamidase kinetics and substrate specificity .

  • Structural Studies: Crystallography efforts focus on GAA1’s M28 domain to elucidate catalytic mechanisms .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements you may have. Please indicate your preference when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. We recommend contacting your local distributor for specific delivery estimates.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be kept at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference for your own formulations.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during production. If you have a preference for a particular tag type, please let us know, and we will prioritize its development.
Synonyms
GAA1; END2; YLR088W; L9449.4; GPI transamidase component GAA1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-614
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
GAA1
Target Protein Sequence
MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISIAILPMDGQYRRTYISENALMP SQAYSYFRESEWNILRGYRSQIKEMVNMTSMERNNLMGSWLQEFGTKTAIYENEQYGETL YGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVFSEN PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLVNI AISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSGWRI QSVTLKAHGNSGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS AVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLLIPSSGL LMTISMASCFLPLILSRKIHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTLAF PMTFVKTIVESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPQQQKQKLKNLVLL ILTNPFISITLFGLFFDDEFHGFDIINKLVSAWLDLKCWSWFVLCIGWLPCWLLILASSF ESKSVVVRSKEKQS
Uniprot No.

Target Background

Function
GAA1 is a component of the GPI transamidase complex. It plays a crucial role in a terminal step of GPI anchor attachment to proteins. Additionally, GAA1 influences endocytosis processes.
Gene References Into Functions
  1. The soluble domains of Gpi8 and Gaa1, two subunits of glycosylphosphatidylinositol transamidase, form a complex. PMID: 28893510
Database Links

KEGG: sce:YLR088W

STRING: 4932.YLR088W

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is GAA1 and what is its role in the GPI transamidase complex?

GAA1 encodes an essential component (Gaa1p) of the GPI transamidase complex that adds glycosylphosphatidylinositols to newly synthesized proteins in Saccharomyces cerevisiae. This complex functions as a key enzyme in the biosynthetic pathway of GPI-anchored proteins, which are critical for numerous cellular functions including cell wall integrity, membrane structure, and signal transduction . The complex operates within the endoplasmic reticulum (ER), where it recognizes proteins containing a C-terminal GPI attachment signal peptide and catalyzes the transamidation reaction that attaches the GPI anchor .

How is the GPI transamidase complex structured and what are its components?

The GPI transamidase complex in S. cerevisiae has been characterized as a high molecular weight complex of approximately 430-650 kDa when solubilized in 1.5% digitonin and analyzed by blue native PAGE . The complex consists of at least three confirmed components:

  • Gaa1p - An essential transmembrane glycoprotein component

  • Gpi8p - The catalytic subunit with homology to cysteine proteases

  • Gpi16p (YHR188c) - An essential N-glycosylated transmembrane glycoprotein

ComponentMolecular WeightLocalizationKey Features
Gaa1pPart of 430-650 kDa complexER membraneEssential for GPI attachment
Gpi8pPart of 430-650 kDa complexER membraneCatalytic subunit
Gpi16pPart of 430-650 kDa complexER membraneN-glycosylated; bulk on lumenal side; C-terminal ER retrieval motif

The complex is not physically associated with the Sec61p complex or the oligosaccharyltransferase complex, suggesting it functions independently in the GPI anchor attachment pathway .

What methods are recommended for isolating and purifying the GPI transamidase complex?

Based on successful experimental approaches documented in the literature, researchers should consider the following methodology for isolating the native GPI transamidase complex:

  • Solubilization Protocol:

    • Use 1.5% digitonin as the detergent of choice for maintaining the integrity of the complex

    • Apply to yeast microsomes containing tagged versions of complex components

    • Maintain cold temperatures (4°C) throughout the process to prevent complex dissociation

  • Purification Approach:

    • Employ affinity purification techniques using tagged versions of Gaa1p or other complex components

    • Blue native PAGE can be used to separate and identify the intact complex (430-650 kDa range)

    • Follow with Western blotting to confirm the presence of complex components

  • Analysis of Complex Composition:

    • Mass spectrometry analysis of affinity-purified complexes can identify all associated proteins

    • SDS-PAGE under reducing conditions can determine the stoichiometry of the complex components

How can researchers effectively analyze GAA1 mutants and their phenotypes?

When studying GAA1 mutants and associated phenotypes, researchers should consider a comprehensive approach that includes:

  • Generation of Conditional Mutants:

    • Since GAA1 is an essential gene, use temperature-sensitive alleles or controllable promoters (e.g., GAL1 promoter for depletion studies)

    • Create point mutations in conserved domains to study structure-function relationships

  • Phenotypic Analysis:

    • Monitor accumulation of complete GPI lipid CP2 as an indicator of transamidase dysfunction

    • Assess levels of unprocessed GPI precursor proteins using Western blotting

    • Analyze cell wall integrity through sensitivity to compounds like Calcofluor White

  • Protein Stability Assessment:

    • Examine the impact of GAA1 mutations on other complex components (e.g., Gpi8p and Gpi16p stability)

    • Use cycloheximide chase experiments to determine protein half-life

How does protein interaction analysis contribute to understanding GAA1 function?

Protein interaction studies are critical for elucidating GAA1's functional relationships within and outside the GPI transamidase complex. The following methodologies are recommended:

  • Synthetic Genetic Array (SGA) Analysis:

    • Similar to approaches used for studying other yeast proteins (e.g., Hrq1), SGA can identify genetic interactions of GAA1 with the yeast deletion collection

    • Cross GAA1 mutants with the S. cerevisiae single-gene deletion collection to generate double mutants

    • Quantitative scoring based on colony size can identify both negative (synthetic sick/lethal) and positive interactions (epistatic or suppression)

  • Physical Interaction Studies:

    • Affinity purification coupled with mass spectrometry (AP-MS) to identify proteins physically interacting with Gaa1p

    • Techniques like proximity-dependent biotin identification (BioID) can identify transient or weak interactors

    • Yeast two-hybrid screening to identify direct binding partners

  • Data Integration:

    • Combine genetic and physical interaction data to build comprehensive interaction networks

    • Use GO term enrichment analysis to identify biological processes connected to GAA1 function

What are the current challenges in studying the structure-function relationship of GAA1?

Several significant challenges exist in elucidating the structure-function relationship of GAA1:

How should researchers interpret contradictory data regarding GAA1 function?

When confronted with contradictory data regarding GAA1 function, researchers should:

  • Systematically Evaluate Experimental Conditions:

    • Different yeast strains may yield varying results due to genetic background effects

    • Growth conditions, media composition, and temperature can significantly impact GPI biosynthesis

    • Analyze the specific experimental designs using approaches similar to those described for on-farm research

  • Statistical Framework for Resolving Contradictions:

    • Apply rigorous statistical methods to determine if contradictions are statistically significant

    • Consider the spatial structure of experiments and its impact on estimator efficiency and accuracy

    • Increase replications with smaller experimental units rather than fewer large ones to improve accuracy

  • Data Integration Approach:

    • Develop a comprehensive model that accounts for seemingly contradictory observations

    • Consider that contradictions may reveal previously unknown regulatory mechanisms or functional redundancies

    • Use experimental designs with appropriate controls to directly test competing hypotheses

What experimental design principles should be applied to GAA1 research?

When designing experiments to study GAA1 and the GPI transamidase complex, researchers should consider:

  • Replicate Design Considerations:

    • Include sufficient biological and technical replicates to ensure statistical power

    • Use randomization to minimize systematic bias in experimental setups

    • Consider that randomization may increase uncertainty of model estimators in some contexts

  • Control Selection:

    • Include appropriate positive and negative controls for each experiment

    • When studying GAA1 mutants, compare to both wild-type and other GPI transamidase component mutants

    • Consider using catalytically inactive mutants (similar to hrq1-K318A) as controls

  • Spatial Methods and Analysis:

    • Apply spatial methods that are robust to changes in experimental structure

    • Be aware that unaddressed changes in experimental parameters can significantly affect Type I error rates

    • Incorporate methods to account for spatial autocorrelation in data analysis

Experimental ApproachAdvantagesLimitationsBest Applications
Single gene deletionClear phenotype attributionLethal for essential genes like GAA1Initial functional characterization
Conditional expressionWorks with essential genesPossible leaky expressionTemporal studies of protein function
Point mutationsPrecise structure-function insightsMay have subtle phenotypesMechanistic studies of catalysis
Fusion proteins (e.g., TAP-tag)Enables complex purificationMay affect protein functionInteraction studies
Synthetic genetic arraysReveals genetic interactionsLabor intensivePathway and network analysis

How does research on GAA1 contribute to our understanding of eukaryotic cell biology?

Research on GAA1 and the GPI transamidase complex provides important insights into fundamental aspects of eukaryotic cell biology:

  • Conserved Post-translational Modification Mechanisms:

    • GAA1 homologs are found in all eukaryotes, suggesting a conserved mechanism for GPI anchor attachment

    • Understanding this process in yeast provides a model for similar processes in higher eukaryotes

  • Protein Quality Control and ER Function:

    • The GPI transamidase complex is part of the ER quality control system

    • Studies of GAA1 help elucidate how cells ensure proper protein modification and trafficking

  • Cell Surface Organization and Function:

    • GPI-anchored proteins are critical for cell surface organization

    • GAA1 research contributes to understanding how cells establish and maintain their surface properties

What emerging technologies are advancing GAA1 research?

Several cutting-edge technologies are enhancing our ability to study GAA1 and the GPI transamidase complex:

  • CRISPR-Cas9 Gene Editing:

    • Enables precise manipulation of GAA1 and other complex components

    • Facilitates the creation of conditional alleles and tagged versions for localization studies

  • Advanced Imaging Techniques:

    • Super-resolution microscopy provides insights into the subcellular localization and dynamics of GAA1

    • Live-cell imaging with fluorescently tagged proteins reveals temporal aspects of complex assembly

  • Integrative Multi-omics Approaches:

    • Combining genomics, proteomics, and metabolomics provides a comprehensive view of GAA1 function

    • Similar to approaches used in the Hrq1 interactome study, these methods can reveal unexpected connections to processes such as transcription and DNA repair

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.