Recombinant Saccharomyces cerevisiae High osmolarity signaling protein SHO1 (SHO1)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant Saccharomyces cerevisiae High Osmolarity Signaling Protein SHO1 (SHO1) is a full-length, His-tagged protein expressed in E. coli (accession: E7KMS3) . Key structural and functional features include:

PropertyDescription
Protein Length367 amino acids (1-367aa)
DomainsFour transmembrane domains (TM1-TM4) and a C-terminal SH3 domain
Expression SystemE. coli
Purification>90% purity via SDS-PAGE
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0); stable at -20°C/-80°C

The recombinant protein retains native functionality, including osmosensing and interaction with downstream signaling components like Pbs2 MAP kinase kinase .

Functional Role in Signaling Pathways

SHO1 serves as a critical adaptor protein in the High Osmolarity Glycerol (HOG) pathway and filamentous growth signaling:

Key Signaling Interactions

Interaction PartnerFunctional Role
Pbs2Directly activates Hog1 MAP kinase via phosphorylation
Opy2Transmembrane domain interaction enhances signaling efficiency of the HOG pathway
Ste11/Ste50Links to MAP kinase cascades for stress adaptation and morphogenesis
Msb2/Hkr1Co-osmosensors that activate SHO1-dependent pathways under osmotic stress

SHO1 mutants exhibit sensitivity to oxidative stress (e.g., H₂O₂, menadione) and defective cell wall biogenesis, leading to aggregation phenotypes .

Oxidative Stress Response

  • Defective Oxidative Adaptation: sho1 mutants display hypersensitivity to oxidative stressors due to impaired Hog1 activation .

  • Alternative Signaling: The Sln1-Ssk1 branch compensates for Hog1 activation in sho1 mutants under osmotic stress .

Cell Wall Biogenesis

  • Structural Defects: sho1 mutants exhibit altered cell wall architecture, including hypersensitivity to Congo red and calcofluor white .

  • Cek1 MAP Kinase Regulation: Constitutive Cek1 activation in hog1 and ssk1 mutants correlates with cell wall remodeling and Congo red resistance .

Morphogenesis

  • Hyphal Growth Defects: sho1 mutants fail to form hyphae under nitrogen starvation (SLAD/Spider media) or mannitol induction .

  • Epistatic Interaction: hog1 deletion suppresses sho1 filamentation defects, indicating Hog1's repressive role in morphogenesis .

Applications in Research

Recombinant SHO1 is widely used to study:

  1. Osmotic Stress Signaling: Mechanistic insights into HOG pathway activation .

  2. Fungal Pathogenesis: Role in Candida albicans virulence via cell wall remodeling .

  3. MAP Kinase Cross-Talk: Interactions between Hog1 and Cek1 pathways .

Future Directions

  1. Structural Studies: Cryo-EM analysis of SHO1-Opy2 transmembrane interactions .

  2. Therapeutic Targeting: Exploiting SHO1-dependent pathways for antifungal drug development .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
SHO1; SSU81; SCY_1620; High osmolarity signaling protein SHO1; Osmosensor SHO1; Suppressor of SUA8-1 mutation; Synthetic high osmolarity-sensitive protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-367
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain YJM789) (Baker's yeast)
Target Names
SHO1
Target Protein Sequence
MSISSKIRPTPRKPSRMATDHSFKMKNFYADPFAISSISLAIVSWVIAIGGSISSASTNE SFPRFTWWGIVYQFLTICSLMLFYCFDLVDHYRIFITTSIAVAFVYNTNSATNLVYADGS KKAAASAGVILLSIINLIWILYYGGDNASPTNRWIDSFSIKGIRPSPLENSLHRARRRGN RNTTPYQNNVYNDAIRDSGYATQFDGYPQQQPSHTNYVSSTALAGFENTQPNTSEAVNLH LNTLQQHINSASNAKETNDNSNNQTNTNIGNTFDTDFSNGNTETTMGDTLGLYSDIGDDN FIYKAKALYPYDADDDDAYEISFEQNEILQVSDIEGRWWKARRANGETGIIPSNYVQLID GPEEMHR
Uniprot No.

Target Background

Function
This protein is a plasma membrane osmosensor that activates the high osmolarity glycerol (HOG) MAPK signaling pathway in response to high osmolarity. It detects changes in external osmolarity and activates PBS2 through the stimulation of STE11, targeting PBS2 to the plasma membrane. The activation of PBS2 leads to changes in glycerol production, helping to balance intracellular and external osmotic pressures. It also activates HOG1 in response to heat stress and mediates resistance to oxidative stress. Furthermore, it is involved in the regulation of the mating pathway and may function as a receptor that contributes to the pseudohyphal growth pathway.
Protein Families
SHO1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Bud. Bud neck. Cell projection.

Q&A

What is the structural organization of the SHO1 protein?

SHO1 is organized as a four-transmembrane (four-TM) protein in Saccharomyces cerevisiae with specific functional domains that facilitate its role as an osmosensor and adaptor protein . The protein contains a C-terminal SH3 domain that is critical for protein-protein interactions with downstream signaling components. This SH3 domain specifically mediates binding with proteins like Ahk1, as demonstrated through coimmunoprecipitation assays where mutations in this domain (ΔSH3 or W338F) abolished Ahk1 binding . The transmembrane domains anchor SHO1 in the plasma membrane, positioning it appropriately to sense environmental osmotic changes and transmit signals intracellularly.

The functional architecture of SHO1 allows it to serve as both a sensor and scaffolding protein, facilitating the assembly of signaling complexes necessary for appropriate stress responses. Structural studies have shown that SHO1's organization enables it to interact with multiple proteins simultaneously, creating a hub for signal integration and transmission in response to osmotic stress.

How does SHO1 function in the HOG signaling pathway?

SHO1 functions as a crucial component of one branch of the high-osmolarity glycerol (HOG) mitogen-activated protein kinase pathway in Saccharomyces cerevisiae . In this pathway, SHO1 serves as an osmosensor that, upon activation by osmotic stress, initiates a signaling cascade that ultimately leads to the activation of the Hog1 MAP kinase. The pathway operates through the following sequence: osmostress activates the Ste11 MAPKKK, which then sequentially activates Pbs2 (MAPKK) and finally Hog1 (MAPK) .

SHO1 contributes to signaling in multiple ways. First, it is constitutively bound to Pbs2, positioning this MAPKK for activation . Second, upon osmotic stress, there is enhanced binding between Ste50 (which is constitutively bound to Ste11) and SHO1, which brings Ste11 into proximity with Pbs2, facilitating signal transduction . This stress-induced proximity of pathway components represents a key regulatory mechanism for HOG pathway activation.

The SHO1 branch operates parallel to the SLN1-SSK1 branch of the HOG pathway, providing redundancy in osmotic stress sensing. In normal conditions, either branch is sufficient for osmoadaptation, as evidenced by the finding that double ssk1 sho1 mutants can still grow on high-osmolarity media and activate Hog1, suggesting alternative inputs to the pathway .

What phenotypes are observed in SHO1 deletion mutants?

SHO1 deletion mutants in both Saccharomyces cerevisiae and Candida albicans exhibit multiple phenotypes that reveal the protein's diverse functional roles. In Candida albicans, sho1 mutants display several characteristic phenotypes:

  • Sensitivity to oxidative stress, indicating SHO1's role in oxidative stress resistance

  • Enhanced susceptibility to cell wall-interfering compounds such as Congo red and calcofluor white, suggesting altered cell wall architecture

  • Cell aggregation, further supporting the role of SHO1 in proper cell wall biogenesis

  • Defects in morphogenesis, particularly:

    • Abolished pseudohyphal growth under nitrogen starvation on solid media

    • Defective hypha formation in response to mannitol on solid medium

    • Impaired filamentation on specific media that stimulate hyphal growth, such as SLAD and Spider media

These phenotypes collectively demonstrate SHO1's importance in stress response, cell wall integrity, and morphogenesis across fungal species.

How can researchers effectively study SHO1 protein-protein interactions in experimental systems?

To effectively study SHO1 protein-protein interactions, researchers can employ several complementary approaches:

Coimmunoprecipitation (coIP) assays: This is a powerful method for examining protein-protein interactions in vivo. As demonstrated in the literature, GST-tagged Ahk1 and HA-tagged SHO1 can be coexpressed in yeast cells, followed by immunoprecipitation of GST-Ahk1 from cell lysates and probing for coprecipitation of HA-SHO1 through immunoblotting . This approach can confirm direct interactions and can be performed under different conditions (e.g., with or without osmotic stress using 1M NaCl) to assess condition-dependent interactions.

Domain mapping through deletion mutants: Using mutants that lack specific domains (e.g., ΔSH3 SHO1 mutants) or contain point mutations in functional domains (e.g., W338F in the SH3 domain) can help identify the specific regions required for protein interactions . Similarly, creating deletion mutants of interaction partners (like the Δ3, Δ4, and Δ5 Ahk1 mutants described) can help map binding interfaces on both proteins .

Experimental protocol for coIP analysis of SHO1 interactions:

  • Generate expression constructs:

    • Create N-terminally HA-tagged SHO1 constructs

    • Generate GST-tagged constructs of potential interaction partners

    • Include domain deletion variants and point mutants

  • Transform and express in appropriate yeast strains:

    • Use strains with relevant genotypic backgrounds (e.g., wild-type or specific pathway mutants)

    • Induce expression using suitable promoters

  • Cell lysis and immunoprecipitation:

    • Harvest and lyse cells under non-denaturing conditions

    • Perform immunoprecipitation using anti-GST antibodies

    • Wash precipitates thoroughly to remove non-specific binding

  • Analysis of interaction:

    • Perform SDS-PAGE and Western blotting

    • Probe with anti-HA antibodies to detect coprecipitated SHO1

    • Include appropriate controls (input samples, negative controls)

  • Condition testing:

    • Compare binding under normal and stress conditions

    • Test different osmotic stressors (NaCl, sorbitol)

    • Examine time-dependence of interactions following stress application

This methodological approach has successfully identified interactions between SHO1's SH3 domain and the C-terminal region of Ahk1 (residues 626 to 984) , demonstrating its effectiveness for characterizing SHO1's interaction network.

What is the relationship between SHO1 and MAP kinase activation in different fungal species?

SHO1's relationship with MAP kinase activation exhibits important species-specific variations that reflect evolutionary adaptations in stress response mechanisms:

In Saccharomyces cerevisiae:
SHO1 primarily functions in the HOG pathway, where it contributes to Hog1 MAP kinase activation in response to osmotic stress. The SHO1 branch operates parallel to the SLN1-SSK1 branch, providing redundancy in osmosensing mechanisms . The activation sequence involves Ste11 (MAPKKK) → Pbs2 (MAPKK) → Hog1 (MAPK) .

In Candida albicans:
SHO1 displays more complex relationships with MAP kinase pathways:

  • HOG pathway: Unlike in S. cerevisiae, SHO1 plays only a minor role in transmitting phosphorylation signals to the Hog1 MAP kinase in response to oxidative stress . The main transmission occurs through the putative Sln1-Ssk1 branch of the HOG pathway .

  • Cek1 pathway: SHO1 is essential for activation of the Cek1 MAP kinase under conditions that require active cell growth and/or cell wall remodeling, such as resumption of growth after stationary phase . This represents a distinct function from its role in S. cerevisiae.

  • Cross-pathway regulation: In C. albicans, Hog1 negatively regulates filamentous growth, while Cek1 promotes it. SHO1 connects these pathways by:

    • Being required for Cek1 activation

    • Contributing to proper cell wall architecture that influences Hog1 activity

An important observation is that Cek1 MAP kinase is constitutively active in hog1 and ssk1 mutants in C. albicans, and this correlates with their resistance to the cell wall inhibitor Congo red . Furthermore, deletion of SHO1 in either an ssk1 or hog1 background suppresses both Congo red resistance and Cek1 basal activation, confirming SHO1's essential role in Cek1 activation .

Comparative MAP kinase activation model:

SpeciesSHO1's Role in Hog1 ActivationSHO1's Role in Other MAPK PathwaysEffect of SHO1 Deletion on Filamentation
S. cerevisiaeMajor component of one branchMinimalAbolishes pseudohyphal growth
C. albicansMinor roleEssential for Cek1 activationDefective in various hypha-inducing conditions

This species-specific variation highlights the importance of studying SHO1 in multiple organisms to fully understand its evolved functions and signaling roles.

How do osmosensors Hkr1 and Msb2 interact with SHO1 in signaling pathways?

The interaction between SHO1 and the osmosensors Hkr1 and Msb2 represents a sophisticated signaling mechanism that has been elucidated through detailed molecular studies. The relationship between these components operates as follows:

The SHO1 branch of the HOG pathway involves two putative osmosensors, Hkr1 and Msb2, in addition to SHO1 itself . These three proteins form a complex signaling network with distinct functional relationships:

Experimental approach to study these interactions:

Researchers investigating these interactions typically employ a combination of methods:

  • Genetic analysis: Creating single and double knockout mutants (e.g., hkr1Δ, msb2Δ, hkr1Δ msb2Δ) in different genetic backgrounds (e.g., ssk2/22Δ) to assess functional redundancy and pathway specificity.

  • Domain mapping: Using deletion mutants of specific domains (STR domain, HMH domain) to determine their functional significance.

  • Activation assays: Measuring Hog1 phosphorylation levels using phospho-specific antibodies to assess pathway activation under various conditions and in different mutant backgrounds.

  • Protein-protein interaction studies: Employing techniques like coimmunoprecipitation, yeast two-hybrid assays, or bimolecular fluorescence complementation to map the interaction network.

This intricate signaling network represents a sophisticated osmosensing mechanism that allows yeast cells to respond appropriately to osmotic stress conditions.

What role does SHO1 play in oxidative stress response and cell wall biogenesis?

SHO1 plays multifaceted roles in both oxidative stress response and cell wall biogenesis, particularly in the pathogenic yeast Candida albicans:

Oxidative Stress Response:
SHO1 contributes to oxidative stress resistance through the following mechanisms:

Cell Wall Biogenesis:
SHO1's role in cell wall biogenesis is evidenced by several observations in C. albicans:

  • Cell wall architecture modifications: sho1 mutants display altered cell wall architecture, resulting in:

    • Enhanced susceptibility to cell wall inhibitors like Congo red and calcofluor white

    • A characteristic cell aggregation phenotype

  • Regulation of the Cek1 MAP kinase: SHO1 is essential for the activation of the Cek1 MAP kinase under conditions that require active cell growth and/or cell wall remodeling, such as the resumption of growth upon exit from stationary phase . Cek1 activation appears to be responsible for the construction of a Congo red-resistant cell wall for several reasons:

    • It is the only MAP kinase partially activated under these conditions

    • cek1, hst7, and cst20 mutants (homologs of kss1, ste7, and ste20 in S. cerevisiae), which would be defective in Cek1 activation, are sensitive to Congo red

    • ssk1, hog1, and pbs2 mutants that cause constitutive activation of the Cek1 kinase are resistant to Congo red

  • Pathway integration: Deletion of SHO1 in an ssk1 or hog1 background suppresses both Congo red resistance and Cek1 basal activation in these mutants, demonstrating SHO1's essential role in Cek1 activation and subsequently in cell wall integrity .

Experimental methodologies to study these functions:

  • Stress resistance assays:

    • Spot dilution assays on media containing oxidative stressors (H₂O₂, menadione) or cell wall perturbing agents (Congo red, calcofluor white)

    • Growth curves in liquid media containing various concentrations of stressors

    • Viability assays after acute stress exposure

  • Cell wall analysis techniques:

    • Electron microscopy to visualize cell wall architecture

    • Flow cytometry with cell wall-binding dyes

    • Analysis of cell wall composition (glucan, chitin, mannan content)

    • Aggregation assays to quantify cell-cell adhesion phenotypes

  • Signaling pathway activation:

    • Western blotting with phospho-specific antibodies to monitor MAP kinase activation

    • Transcriptional reporter assays for downstream targets of stress-responsive pathways

    • Epistasis analysis using multiple deletion mutants to establish pathway relationships

These methodological approaches have been instrumental in establishing SHO1's critical roles in linking oxidative stress responses, cell wall biogenesis, and morphogenesis in pathogenic fungi .

How can SHO1 research contribute to antifungal drug development strategies?

SHO1 research provides several promising avenues for antifungal drug development, particularly given its essential roles in stress response, cell wall integrity, and morphogenesis in pathogenic fungi like Candida albicans:

Targeting cell wall integrity pathways:
SHO1's essential role in cell wall biogenesis makes it an attractive target for antifungal development. Research has demonstrated that sho1 mutants have altered cell wall architecture and increased sensitivity to cell wall-perturbing agents . These phenotypes suggest that:

  • SHO1 inhibitors could potentially sensitize fungal pathogens to existing cell wall-targeting antifungals, enabling combination therapies with reduced dosages.

  • Disruption of SHO1-dependent signaling could directly compromise cell wall integrity, particularly during host infection when cell wall remodeling is critical for adaptation to host environments.

Inhibiting morphogenetic transitions:
SHO1's involvement in morphogenesis (particularly the yeast-to-hypha transition in C. albicans) represents another promising target, as hyphal formation is a key virulence factor . Research approaches include:

  • Screening for compounds that specifically inhibit SHO1-dependent morphogenesis without affecting general cell growth.

  • Developing peptide inhibitors that disrupt specific protein-protein interactions, such as those between SHO1's SH3 domain and its binding partners.

Exploiting species-specific differences:
The differences in SHO1 function between pathogenic fungi and the human host can be leveraged for selective targeting:

  • Detailed structural and functional comparisons between fungal SHO1 and any related human proteins can identify unique features that allow selective targeting.

  • Species-specific SHO1 interactions, such as those with Cek1 in C. albicans, may provide targets that selectively affect pathogenic fungi while sparing human cells.

Methodological approaches for drug discovery:

  • Structure-based drug design:

    • Determine high-resolution structures of SHO1 domains, particularly the SH3 domain and transmembrane regions

    • Conduct in silico screening for compounds that bind to key functional surfaces

    • Design peptidomimetics that interfere with specific protein-protein interactions

  • High-throughput screening approaches:

    • Develop yeast-based reporter systems that monitor SHO1-dependent signaling

    • Screen compound libraries for inhibitors of SHO1-dependent phenotypes

    • Utilize cell-based assays that measure hyphal formation or cell wall integrity

  • Validation in infection models:

    • Test candidate inhibitors in established infection models

    • Assess efficacy against biofilm formation, which depends on proper morphogenesis

    • Evaluate combination therapy approaches with existing antifungals

By targeting SHO1's roles in stress response signaling, cell wall integrity, and morphogenesis, researchers can develop novel antifungal strategies that address the growing challenge of antifungal resistance in clinical settings.

What are the critical considerations when studying SHO1 function across different fungal species?

When studying SHO1 function across different fungal species, researchers must address several critical considerations to ensure accurate interpretation and translational significance:

Evolutionary divergence and functional conservation:
SHO1 exhibits both conserved and divergent functions across fungal species. For example, while SHO1 contributes to osmosensing in both S. cerevisiae and C. albicans, its relative importance in HOG pathway activation and its connections to other signaling pathways differ significantly between species . Researchers should:

  • Perform detailed phylogenetic analyses to understand evolutionary relationships between SHO1 proteins across fungal species.

  • Avoid assuming functional conservation without experimental validation, even when sequence conservation is high.

  • Use complementation studies (expressing SHO1 from one species in another species' sho1Δ mutant) to test functional conservation directly.

Species-specific signaling network integration:
The integration of SHO1 into larger signaling networks varies between species:

  • In S. cerevisiae, SHO1 primarily functions in the HOG pathway for osmoadaptation .

  • In C. albicans, SHO1 plays a more prominent role in morphogenesis and cell wall integrity through Cek1 MAP kinase activation, while having a minor role in Hog1 activation during oxidative stress .

These differences necessitate:

  • Comprehensive mapping of interaction partners in each species

  • Careful epistasis analysis using multiple mutant combinations

  • Analysis of downstream transcriptional responses to identify species-specific targets

Experimental design considerations:

  • Genetic background effects:

    • Use multiple strain backgrounds to ensure phenotype consistency

    • Consider the impact of auxotrophic markers, which can influence stress responses

    • Generate clean deletion mutants using scarless techniques when possible

  • Stress condition standardization:

    • Different fungal species have varying baseline tolerances to stress conditions

    • Calibrate stress conditions for each species based on their specific sensitivity ranges

    • Use multiple stress agents to comprehensively assess stress response pathways

  • Comparative methodology:

Methodological ApproachCross-Species Considerations
Growth phenotype analysisAdjust media composition and stress levels for species-specific growth requirements
Protein interaction studiesUse homologous tags and expression systems optimized for each species
Transcriptional profilingAccount for species-specific promoter elements and transcriptional machinery
Microscopy/morphology assessmentConsider species-specific morphological features and development patterns
  • Validation in pathogenesis models:

    • For pathogenic species like C. albicans, validate findings in relevant infection models

    • Consider host-specific factors that may influence SHO1 function during infection

    • Evaluate virulence attributes alongside biochemical and cellular phenotypes

By carefully addressing these considerations, researchers can develop a more nuanced understanding of SHO1 function across fungal species, potentially revealing both conserved mechanisms that can be broadly targeted and species-specific adaptations that may inform pathogen-specific intervention strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.