Recombinant Saccharomyces cerevisiae Hypersensitivity to hygromycin-B protein 1 (HHY1)

Shipped with Ice Packs
In Stock

Description

Definition and Recombinant Production

Recombinant HHY1 is commercially produced in E. coli as a His-tagged fusion protein (1–102 aa) for research applications. Key characteristics include:

ParameterValue
SourceE. coli
TagN-terminal His-tag
LengthFull-length (1–102 aa)
Purity>90% (SDS-PAGE verified)
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
ApplicationsSDS-PAGE, protein interaction studies
Supplier ExamplesMyBioSource.com ($1,150), Creative BioMart (RFL5513SF)

Data compiled from .

Biological Role and Functional Insights

HHY1’s role remains poorly characterized, but genetic studies link it to vacuolar defects. Mutants lacking HHY1 exhibit hypersensitivity to hygromycin B (25 µg/mL), rapamycin, and caffeine, suggesting impaired vacuolar trafficking or TOR pathway regulation .

Key Interactions

Protein interaction networks from STRING highlight potential partners:

PartnerFunctionInteraction Score
ZRG8Zinc-regulated mitochondrial protein0.604
VAM10Vacuole morphogenesis and fusion0.515
SRD1Pre-rRNA processing0.489
SOM1Mitochondrial inner membrane peptidase0.422

Interactions inferred from co-occurrence and coexpression data .

Research Applications and Pathways

HHY1 mutants are primarily used to study vacuolar trafficking and antibiotic resistance:

  1. Vacuolar Defects: hhy1 mutants show impaired vacuole fusion/fission, linking vacuolar dysfunction to hygromycin B sensitivity .

  2. Genomic Screens: HHY1 was identified in a screen for genes causing severe hygromycin B hypersensitivity, alongside VPS34 and ARF1 .

  3. TOR Pathway Sensitivity: hhy1 mutants show enhanced sensitivity to rapamycin, implicating TOR signaling in vacuolar homeostasis .

While not directly involved in protein secretion optimization, studies on S. cerevisiae secretory pathways (e.g., IRE1 overexpression) provide context for engineered strain development .

Open Questions and Future Directions

  • Mechanistic Role: HHY1’s precise function in vacuolar trafficking remains unclear, requiring targeted biochemical assays.

  • Therapeutic Relevance: Hypersensitivity to hygromycin B in hhy1 mutants could inform antibiotic resistance studies in pathogenic fungi.

  • Protein Engineering: Recombinant HHY1 may serve as a tool for studying vacuolar protein localization or trafficking pathways.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
HHY1; YEL059W; Hypersensitivity to hygromycin-B protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
HHY1
Target Protein Sequence
MSLSFLLFSPFLPPCFSSISICLSVLSTVSFFFAFTIPHYVLRCGSVDEWHIHSSAEDFR TQRCVCAVKLSASLLGCLLACASWSLLLEVSRIKWHVGTAYS
Uniprot No.

Target Background

Function
Involved in vacuolar trafficking.
Database Links

STRING: 4932.YEL059W

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the optimal experimental design for initial HHY1 expression studies in S. cerevisiae?

When designing experiments for initial HHY1 expression studies, a systematic approach following established experimental design principles is crucial. Begin by clearly defining your independent variable (typically HHY1 expression levels) and dependent variable (such as cell growth rates, protein yield, or hygromycin-B resistance) . For valid results, implement the following experimental design framework:

  • Establish a control group using wild-type S. cerevisiae without HHY1 modifications

  • Create treatment groups with varying HHY1 expression levels

  • Maintain identical growth conditions across all experimental groups

  • Measure outcomes at predetermined time points (24h, 48h, 72h)

  • Include technical and biological replicates (minimum n=3 for each)

This design allows for robust statistical analysis while controlling for extraneous variables such as temperature fluctuations, media composition, and growth phase differences .

Which S. cerevisiae strain backgrounds are most suitable for HHY1 expression studies?

The selection of an appropriate strain background significantly impacts experimental outcomes in HHY1 studies. Based on systematic protein expression optimization research, the following strains demonstrate differential suitability:

Strain BackgroundAdvantagesLimitationsRecommended Applications
BY4741Well-characterized knockout collections available, established secretory pathwayModerate protein yieldGenetic pathway studies, screening experiments
W303Higher protein expression capacityFewer available genetic toolsHigh-yield protein production
S288CFully sequenced genome, genetic stabilityLower transformation efficiencyLong-term studies, genomic integration
Industrial strainsRobust growth, stress toleranceLess characterized geneticallyScale-up applications

For initial characterization studies, the BY4741 background is particularly valuable due to the availability of systematic knockout collections of secretory pathway genes that can be leveraged to optimize HHY1 expression .

How can I verify successful HHY1 expression in recombinant S. cerevisiae?

Verification of successful HHY1 expression requires a multi-method approach to ensure both accuracy and reliability. Implement the following verification protocol:

  • Molecular verification:

    • PCR confirmation of genomic integration

    • RT-qPCR for transcriptional activity quantification

    • Sanger sequencing to confirm sequence integrity

  • Protein expression verification:

    • Western blot analysis using anti-HHY1 antibodies

    • GFP-fusion protein visualization (if using a reporter construct)

    • Mass spectrometry for definitive protein identification

  • Functional verification:

    • Hygromycin-B resistance assay with concentration gradient (50-500 μg/ml)

    • Growth curve analysis in selective media

This comprehensive verification approach aligns with established protocols for recombinant protein expression in yeast systems and ensures confidence in your experimental system before proceeding to more complex analyses .

What genetic modifications in the protein secretory pathway can enhance HHY1 expression?

Systematic optimization of protein secretory pathways can significantly improve HHY1 expression in S. cerevisiae. Research has demonstrated that targeted genetic perturbations yield dramatic improvements in recombinant protein expression. The following genetic modifications have shown particular promise:

  • Gene deletions with positive effects:

    • ΔYPT32: Deletion leads to a 1.92-fold increase in recombinant protein expression

    • ΔSBH1: Results in a 1.66-fold increase in expression

    • ΔHSP42: Provides a 1.62-fold increase in protein production

  • Gene overexpressions with positive effects:

    • IRE1 overexpression: Yields a 1.3-fold increase in protein expression

    • SSA4 overexpression: Provides a 1.16-fold increase

    • EPS1 overexpression: Results in a 1.14-fold increase

    • OPI1 overexpression: Leads to a 1.09-fold increase

  • Synergistic combinations:

    • ΔYPT32 + IRE1 overexpression: Produces a 2.12-fold increase over wild type

    • ΔSBH1 + IRE1 overexpression: Demonstrates synergistic improvement

The mechanisms underlying these improvements involve modulation of the unfolded protein response (UPR), ER-associated degradation (ERAD), and protein folding processes, which collectively enhance the cell's capacity to produce and process recombinant HHY1.

How can I develop a high-throughput screening method to identify novel factors affecting HHY1 expression?

Developing an effective high-throughput screening system requires careful integration of molecular biology techniques with data analytics approaches. The following methodology provides a framework for comprehensive screening:

  • Library construction:

    • Utilize the BY4741 knockout collection library focusing on 194 single genes deleted in the protein secretory pathway

    • Generate an overexpression library using a pRS415-based vector system with constitutive or inducible promoters

  • Reporter system design:

    • Construct HHY1-GFP fusion proteins for fluorescence-based detection

    • Implement dual reporters (e.g., GFP and RFP) for normalization of expression levels

  • Screening procedure:

    • Miniaturized culture format (96 or 384-well plates)

    • Automated fluorescence measurement at standardized time points

    • Hygromycin-B challenge assay for functional validation

  • Data analysis pipeline:

    • Implement machine learning algorithms for pattern recognition in large datasets

    • Utilize statistical methods to identify significant hits

    • Apply principal component analysis to identify gene clusters with similar effects

This approach enables systematic evaluation of potential genetic targets across the secretory pathway, facilitating discovery of novel factors affecting HHY1 expression beyond the currently known modulators .

What approaches can resolve contradictory data in HHY1 expression studies?

Resolving contradictory data in HHY1 expression studies requires a structured analytical approach. When faced with conflicting results, implement this systematic resolution framework:

  • Methodological reconciliation:

    • Analyze differences in experimental protocols (growth conditions, media composition, measurement techniques)

    • Standardize key methodological parameters across studies

    • Replicate contradictory experiments side-by-side under identical conditions

  • Statistical reanalysis:

    • Apply more robust statistical methods (e.g., Bayesian approaches)

    • Perform meta-analysis when multiple datasets are available

    • Analyze potential sources of bias or confounding variables

  • Strain and genetic background assessment:

    • Verify genetic stability through sequencing

    • Test expression in multiple strain backgrounds

    • Control for potential background mutations

  • Molecular mechanism investigation:

    • Examine potential post-translational modifications

    • Analyze protein localization and trafficking

    • Investigate potential regulatory networks

This systematic approach not only resolves contradictions but often reveals deeper insights into the biological complexity of HHY1 expression regulation in yeast systems .

How do post-translational modifications impact HHY1 function and stability?

Post-translational modifications (PTMs) significantly influence HHY1 protein functionality and stability. Understanding these modifications requires a multi-faceted analytical approach:

  • Identification of key PTMs:

Modification TypeDetection MethodFunctional ImpactRegulation Mechanism
PhosphorylationMS/MS, PhosphoTag gelsActivity modulation, localizationKinase/phosphatase pathways
GlycosylationGlycosidase treatment, lectin bindingFolding, stability, secretionER processing machinery
UbiquitinationIP-Western, MSDegradation targetingERAD pathway
SUMOylationSUMOylation-specific antibodiesProtein-protein interactionsSUMO ligase activity
  • Experimental approaches for PTM analysis:

    • Site-directed mutagenesis of predicted modification sites

    • In vitro enzymatic modification assays

    • Pulse-chase experiments for stability determination

    • Subcellular fractionation to track modified vs. unmodified protein

  • Quantitative assessment of PTM impact:

    • Measure half-life of modified vs. unmodified protein

    • Determine activity differences between modified forms

    • Assess localization changes driven by modifications

    • Quantify binding partner interactions of different PTM states

Understanding these modifications provides crucial insights into regulatory mechanisms controlling HHY1 function and can inform strategies to enhance protein stability and activity through targeted genetic or chemical interventions .

What mathematical models best describe the relationship between HHY1 expression and hygromycin-B resistance?

Mathematical modeling of the relationship between HHY1 expression and hygromycin-B resistance provides predictive power and mechanistic insights. Several modeling approaches have demonstrated utility in this context:

  • Dose-response modeling:

    • The Hill equation effectively describes the sigmoidal relationship between HHY1 expression and hygromycin-B resistance:

    R=Rmax×[HHY1]nEC50n+[HHY1]nR = R_{max} \times \frac{[HHY1]^n}{EC_{50}^n + [HHY1]^n}

    Where R represents resistance level, R_max is maximum resistance, [HHY1] is expression level, EC50 is the HHY1 concentration producing 50% of maximum resistance, and n is the Hill coefficient indicating cooperativity.

  • Time-dependent models:

    • Modified Gompertz function for modeling resistance development over time:

    R(t)=Rmax×exp(exp(k×(λt)+1))R(t) = R_{max} \times exp(-exp(k \times (λ - t) + 1))

    Where R(t) is resistance at time t, k is the rate parameter, and λ is the lag time before resistance develops.

  • Stochastic models:

    • Markov chain models accounting for cell-to-cell variability in expression:

    P(j,t+Δt)=iP(i,t)×Ti,j(Δt)P(j,t+Δt) = \sum_{i} P(i,t) \times T_{i,j}(Δt)

    Where P(j,t) is the probability of state j at time t, and T_i,j is the transition probability from state i to j.

These models can be fitted to experimental data using non-linear regression techniques, and model selection should be guided by Akaike Information Criterion (AIC) or Bayesian Information Criterion (BIC) to identify the most appropriate mathematical representation .

How can I design experiments to elucidate the molecular mechanism of HHY1-mediated hygromycin-B resistance?

Elucidating the molecular mechanism of HHY1-mediated hygromycin-B resistance requires a comprehensive experimental strategy targeting multiple aspects of cellular function:

  • Interaction mapping experiments:

    • Yeast two-hybrid screening to identify HHY1 binding partners

    • Co-immunoprecipitation coupled with mass spectrometry

    • Proximity labeling methods (BioID, APEX) for in vivo interaction detection

    • FRET/BRET analysis for direct physical interactions

  • Localization and trafficking studies:

    • Fluorescence microscopy with subcellular markers

    • Live-cell imaging with time-lapse monitoring

    • Subcellular fractionation with quantitative western blotting

    • Electron microscopy for ultrastructural localization

  • Functional domain mapping:

    • Systematic truncation and domain swapping experiments

    • Site-directed mutagenesis of conserved residues

    • Chimeric protein construction

    • Heterologous complementation assays

  • Resistance mechanism characterization:

    • Ribosome binding and translation inhibition assays

    • Drug uptake and efflux measurements

    • Drug modification/inactivation assays

    • Comparative transcriptomics and proteomics with and without HHY1

This experimental framework allows for systematic interrogation of the mechanistic basis of HHY1-mediated resistance, generating testable hypotheses about functional domains, interaction partners, and cellular pathways involved .

What bioinformatic approaches can predict the impact of mutations on HHY1 function?

Bioinformatic prediction of mutation impacts on HHY1 function leverages computational tools and evolutionary information to guide experimental work. Implement this comprehensive bioinformatic framework:

  • Sequence-based predictions:

    • Multiple sequence alignment across fungal species to identify conserved regions

    • Calculation of evolutionary conservation scores (e.g., ConSurf analysis)

    • Prediction of functionally important sites using entropy-based methods

    • Identification of known functional motifs and domains

  • Structure-based predictions:

    • Homology modeling of HHY1 structure

    • Molecular dynamics simulations of wild-type and mutant proteins

    • Energy calculation changes (ΔΔG) upon mutation

    • Protein-protein docking predictions with potential partners

  • Machine learning approaches:

    • Random forest classifiers trained on known mutation effects

    • Support vector machines for stability change predictions

    • Deep learning networks integrating multiple features

    • Ensemble methods combining multiple predictors

  • Systems-level predictions:

    • Network analysis of HHY1 in protein interaction networks

    • Pathway enrichment analysis

    • Flux balance analysis in metabolic models

    • Gene essentiality predictions in different genetic backgrounds

This multi-layered bioinformatic approach provides prioritization of mutations for experimental validation and generates mechanistic hypotheses about how specific amino acid changes might affect HHY1 function in the context of hygromycin-B resistance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.