Recombinant Saccharomyces cerevisiae Inorganic phosphate transport protein PHO88 (PHO88)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, and may be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
PHO88; SND3; YBR106W; YBR0835; SRP-independent targeting protein 3; Inorganic phosphate transport protein PHO88; Phosphate metabolism protein PHO88
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
PHO88
Target Protein Sequence
MNPQVSNIIIMLVMMQLSRRIDMEDPTIIMYIRILYCSSIGISWIIYQMARKRIVAKNDM TTMKYVEPGNAMSGEGEKLQVTTVRDYDLKEIDSAIKSIYTGMAMMGFMHLYLKYTNPLF MQSISPVKSALEHNEVKIHLFGKPATGDLKRPFKAPSLFGGMGQTGPKTDKKSIEEAERA GNAGVKAE
Uniprot No.

Target Background

Function

Recombinant Saccharomyces cerevisiae Inorganic phosphate transport protein PHO88 (PHO88) functions within the SND pathway, a process independent of the SRP (signal recognition particle) and GET (guided entry of tail-anchored proteins) pathways. This pathway targets a wide range of substrate proteins to the endoplasmic reticulum. SND operates concurrently with GET in targeting proteins possessing downstream hydrophobic motifs. PHO88 is involved in inorganic phosphate uptake, telomere length regulation, and maintenance.

Database Links

KEGG: sce:YBR106W

STRING: 4932.YBR106W

Protein Families
PHO88 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion.

Q&A

What is PHO88 and what is its fundamental role in Saccharomyces cerevisiae?

PHO88 encodes a putative membrane protein involved in inorganic phosphate (Pi) transport in Saccharomyces cerevisiae. It was identified as a multicopy suppressor of the rAPase-negative phenotype caused by Pi inhibition of Pho81p . Structurally, Pho88 is a 21kDa protein consisting of 188 amino acid residues with 51.60% hydrophobic, 28.72% hydrophilic, and 19.68% neutral amino acids . The protein is functionally localized to the endoplasmic reticulum and is believed to play a significant role in the regulation or maturation of secretory proteins acting in the phosphate transport pathway .

When studying PHO88 function, researchers should employ a combination of approaches:

  • Gene disruption/overexpression experiments

  • Protein localization studies

  • Pi uptake measurements

  • Phenotypic analysis under varying phosphate conditions

How does PHO88 relate to the broader PHO regulon and phosphate homeostasis mechanisms?

PHO88 functions within the broader phosphate regulatory network known as the PHO regulon. This system controls the expression of genes involved in phosphate acquisition and metabolism in response to environmental phosphate availability. The table below outlines key components of this system:

ComponentFunctionRegulatory Role
PHO88Putative membrane proteinModulates Pho81p function; involved in Pi transport
PHO86Putative membrane proteinAssociated with Pi transporter complex
PHO81Regulatory proteinPrimary receptor for Pi signals; inhibits PHO80/PHO85 under low Pi
PHO4Transcription factorActivates expression of PHO genes during phosphate starvation
PHO5Repressible acid phosphataseFunctions as phosphate scavenger under low Pi conditions
PHO80/PHO85Cyclin/CDK complexPhosphorylates PHO4, regulating its localization

Methodologically, studying PHO88's role in this network requires analysis of not just PHO88 itself but also its interactions with other components, particularly under varying phosphate conditions .

Where is Pho88p localized within yeast cells and how does this relate to its function?

Pho88p has been determined to be an endoplasmic reticulum (ER)-resident protein . This localization is significant for several reasons:

  • The hydropathy profile and cellular localization analysis suggest that Pho88p is a membrane protein similar to Pho86p .

  • Its ER localization positions it strategically for involvement in the maturation or trafficking of phosphate transporters to the plasma membrane .

  • PDZD8-Venus has been shown to colocalize with yeast ER-resident protein Pho88, suggesting conserved and functional ER targeting mechanisms .

To study Pho88p localization, researchers have employed:

  • Hydropathy profile analysis to predict membrane topology

  • Cellular fractionation followed by immunoblotting

  • Fluorescent protein tagging for microscopy visualization

What is the relationship between PHO88 and PHO86 in phosphate transport regulation?

PHO88 and PHO86 appear to have complementary but distinct roles in phosphate transport regulation. The evidence for their functional relationship includes:

  • Both are membrane proteins with similar hydropathy profiles .

  • Single and double disruption studies show differential effects on phosphate uptake:

    • The pho86 disruptant expressed rAPase activity in high-Pi medium, while the pho88 disruptant did not .

    • The double disruption (Δpho86 Δpho88) resulted in enhanced synthesis of rAPase under high-Pi conditions and conferred arsenate resistance .

  • Both disruption and high dosage of either PHO88 or PHO86 resulted in reduced Pi uptake, suggesting a complex dose-dependent relationship .

This comparative data suggests Pho88p and Pho86p work together to modulate Pho81p function, which is a key regulator in the phosphate signaling pathway .

Experimental ConditionEffect on rAPase ActivityPi UptakeOther Phenotypes
Wild-typeRepressed in high PiNormal-
Δpho88Repressed in high PiReduced-
Δpho86Expressed in high PiReduced-
Δpho88 Δpho86Enhanced in high PiReducedArsenate resistance
PHO88 overexpression-Reduced-
PHO86 overexpression-ReducedActivates Pi-inhibited Pho81p

How does PHO88 influence the molecular mechanisms of phosphate signaling?

The molecular mechanisms by which PHO88 influences phosphate signaling involve several key interactions:

  • Modulation of Pho81p function: Pho88p works together with Pho86p to modulate the function of Pho81p, which is a primary receptor for Pi signaling .

  • Involvement in Pi transport: Both disruption and high dosage of PHO88 result in reduced Pi uptake, suggesting a role in maintaining optimal phosphate transport capacity .

  • Potential role in protein maturation: It has been suggested that Pho88 and Pho86 may function by binding to the phosphate transporter Pho84 to promote its maturation or trafficking to the plasma membrane .

  • Signal cascade involvement: Pho88 could indirectly regulate the expression of PHO genes by relaying information between Pi receptors at the cell membrane and transcription factors such as Pho4 in the nucleus .

The phosphate signaling cascade in yeast follows this general pathway:

  • Under low Pi: PHO81 inhibits PHO80/PHO85 → PHO4 remains unphosphorylated → PHO4 accumulates in nucleus → PHO genes are expressed

  • Under high Pi: PHO80/PHO85 phosphorylates PHO4 → PHO4 is exported from nucleus → PHO gene expression is repressed

PHO88 appears to act at an early stage of this pathway, potentially influencing how cells sense and respond to phosphate availability.

What are the current experimental challenges in studying PHO88 function?

Researchers face several significant challenges when studying PHO88 function:

  • Functional redundancy: The overlapping functions between PHO88 and PHO86 complicate single-gene studies, necessitating careful interpretation of knockout phenotypes .

  • Complex dosage effects: Both disruption and overexpression of PHO88 result in reduced Pi uptake, suggesting a non-linear relationship between PHO88 levels and function .

  • Environmental dependencies: The phenotypes associated with PHO88 disruption may only manifest under specific phosphate conditions, requiring careful experimental design .

  • Indirect regulatory effects: As a potential regulator of other phosphate transport proteins, the effects of PHO88 manipulation may be indirect and difficult to distinguish from direct effects .

  • Technical limitations: Membrane protein analysis presents inherent challenges for structural and interaction studies, complicating detailed mechanistic investigations .

Advanced experimental approaches to address these challenges include:

  • Combined genetic and biochemical analyses

  • Systems biology approaches to map regulatory networks

  • Conditional expression systems

  • In vitro reconstitution of transport complexes

How should I design experiments to investigate PHO88 function in the phosphate transport pathway?

When designing experiments to study PHO88 function, consider the following methodological approaches:

  • Gene disruption and complementation studies:

    • Create PHO88 deletion strains using homologous recombination

    • Compare single (Δpho88) and double (Δpho88 Δpho86) knockouts to understand redundancy

    • Perform complementation tests with wild-type PHO88 to confirm phenotype specificity

  • Expression analysis under varying phosphate conditions:

    • Northern blot analysis or qPCR to measure PHO88 transcript levels

    • Western blot analysis with antibodies against Pho88p

    • Reporter gene assays using the PHO88 promoter

  • Enzyme activity assays to measure downstream effects:

    • For measuring rAPase (Pho5) activity: Mix 1.5mL acetate buffer (pH=4), 0.5mL of 0.4M 4-nitrophenyl phosphate, and 0.5mL supernatant containing Pho5

    • Compare activity between wild-type and mutant strains under varying phosphate conditions

  • Protein localization and interaction studies:

    • Fluorescent protein tagging to visualize subcellular localization

    • Co-immunoprecipitation to identify interacting partners

    • Two-hybrid assays to screen for potential protein interactions

  • Phosphate uptake measurements:

    • Use radioactive 32P or 33P to directly measure phosphate uptake rates

    • Compare uptake kinetics between wild-type and mutant strains

Control experiments should include:

  • Wild-type strains grown under identical conditions

  • Single gene knockouts (pho88Δ and pho86Δ) alongside double knockouts

  • Media controls with varying phosphate concentrations

What methods can be used to study the structure-function relationship of Pho88p?

To investigate the structure-function relationship of Pho88p, researchers can employ several complementary approaches:

  • Computational analysis:

    • Hydropathy plot analysis to predict membrane-spanning regions

    • Homology modeling based on related proteins with known structures

    • Sequence conservation analysis across species to identify functional domains

  • Mutational analysis:

    • Site-directed mutagenesis of conserved residues

    • Domain deletion/swapping experiments

    • Creation of chimeric proteins with related transporters

  • Biochemical characterization:

    • Membrane topology mapping using protease protection assays

    • Chemical crosslinking to identify interacting domains

    • Limited proteolysis to define domain boundaries

  • Functional reconstitution:

    • Expression and purification of recombinant Pho88p

    • Reconstitution into proteoliposomes to assess functional properties

    • Similar to approaches used for Pho89, another phosphate transporter

  • Advanced structural biology techniques:

    • Cryo-electron microscopy for membrane protein structure determination

    • X-ray crystallography (challenging for membrane proteins)

    • NMR spectroscopy for dynamic structural information

These approaches can help elucidate how Pho88p's structure relates to its role in phosphate transport and signaling.

How can I apply systems biology approaches to study PHO88 in the context of the entire phosphate regulatory network?

Systems biology offers powerful approaches to understand PHO88's role within the broader phosphate regulatory network:

  • Transcriptomic analysis:

    • Compare gene expression profiles between wild-type and pho88Δ strains

    • Identify differentially expressed genes in response to varying phosphate conditions

    • Similar to the approaches used in search result , which identified 1245 differentially expressed genes

  • Environment and Gene Regulatory Influence Network (EGRIN) analysis:

    • Integrate large-scale mRNA expression data to identify co-regulated gene modules

    • Infer regulatory relationships between transcription factors and target genes

    • This approach has been successful in studying other yeast regulatory networks

  • Multi-level experimental strategy:

    • Level 1: Global network analysis from compendium data

    • Level 2: Condition-specific enhancements with targeted experiments

    • Level 3: Gene-level analysis with multiple streams of evidence

  • Protein-protein interaction mapping:

    • Identify physical interactions between Pho88p and other components of the phosphate transport/signaling machinery

    • Use co-immunoprecipitation followed by mass spectrometry

  • Metabolic profiling:

    • Measure phosphate-related metabolites in wild-type and mutant strains

    • Identify metabolic changes associated with PHO88 disruption

The EGRIN approach described in is particularly relevant as it combines:

  • Conditionally coherent gene expression modules (biclusters)

  • Regulatory influence predictions

  • Integration of multiple data types (expression, binding, motif)

  • Iterative refinement with condition-specific experiments

How should I interpret seemingly contradictory results in PHO88 studies?

When facing contradictory results in PHO88 research, consider these analytical approaches:

  • Examine experimental conditions carefully:

    • Phosphate concentration is critical - effects may only manifest under specific Pi levels

    • Growth phase can influence gene expression patterns

    • Media composition beyond phosphate can affect results

  • Consider strain background effects:

    • Genetic differences between laboratory strains may alter PHO88 phenotypes

    • Population structure in S. cerevisiae is complex with over 20.5% of sites being polymorphic across strains

  • Evaluate redundancy and compensation:

    • PHO86 may compensate for PHO88 loss in some conditions

    • Other phosphate transporters may be upregulated in response to PHO88 deletion

  • Examine dose-dependent effects:

    • Both deletion and overexpression of PHO88 reduce Pi uptake

    • Non-linear relationships between protein levels and function are common

  • Temporal considerations:

    • Short-term vs. long-term effects may differ substantially

    • Adaptation mechanisms may mask initial phenotypes

When reporting seemingly contradictory results, clearly document all experimental conditions and strain information to facilitate proper interpretation.

What statistical approaches are most appropriate for analyzing PHO88 functional data?

When analyzing functional data related to PHO88, several statistical approaches are recommended:

When reporting results, present both raw data and derived statistical measures, and clearly state the specific tests and thresholds used.

How can I distinguish direct versus indirect effects of PHO88 on phosphate transport?

Distinguishing direct from indirect effects of PHO88 requires multiple complementary approaches:

  • Temporal analysis:

    • Immediate versus delayed responses to PHO88 manipulation

    • Time-course experiments to establish order of events

  • Genetic approaches:

    • Epistasis analysis with other phosphate pathway components

    • Double mutant analysis (e.g., pho88Δ combined with mutations in downstream factors)

  • Biochemical methods:

    • Direct binding assays between Pho88p and putative interactors

    • In vitro reconstitution of transport activity

    • Similar to approaches used for Pho89

  • Multi-level validation:

    • Combine multiple streams of evidence (expression, binding, genetic)

    • As described in search result : "At Level 3, we only consider those regulatory relationships that are reinforced by two or more streams of evidence"

  • Quantitative models:

    • Develop mathematical models of the phosphate transport system

    • Test predictions with experimental manipulation

    • Separate direct effects from network-level responses

A direct effect of PHO88 would be expected to:

  • Occur rapidly after manipulation

  • Persist in the absence of downstream factors

  • Show physical interaction with the affected component

  • Be reproducible in simplified experimental systems

How can I effectively express and purify recombinant Pho88p for structural and functional studies?

Based on approaches used for related phosphate transporters, the following protocol is recommended for Pho88p:

  • Expression system selection:

    • Pichia pastoris has been successfully used for expressing the related phosphate transporter Pho89

    • Consider using strong inducible promoters like GAL1 or heterologous systems like the GEV activator

  • Construct design considerations:

    • Include affinity tags (His, FLAG) for purification

    • Consider fusion partners to enhance solubility

    • Preserve native transmembrane domains

  • Expression optimization:

    • Test different induction conditions (temperature, inducer concentration)

    • Monitor expression levels via Western blotting

    • Assess functionality in intact cells before purification

  • Membrane protein purification:

    • Solubilize membranes with appropriate detergents (DDM, LDAO)

    • Use two-step purification (affinity chromatography followed by size exclusion)

    • Maintain protein stability with lipids or stabilizing agents

  • Functional reconstitution:

    • Incorporate purified protein into proteoliposomes

    • Verify incorporation by Western blotting

    • Assess functionality through transport assays

For functional verification, search result describes how researchers confirmed Pho89 activity: "Pi uptake activity of the clone expressing Pho89 was greatly increased in the presence of NaCl (four-fold to five-fold induction), whereas no Pi uptake activity above background level could be detected in the absence of NaCl."

What are the most effective methods for studying PHO88 regulation in response to changing phosphate conditions?

To study PHO88 regulation under varying phosphate conditions, employ these methodological approaches:

  • Transcriptional regulation analysis:

    • Use reporter constructs with the PHO88 promoter

    • Perform chromatin immunoprecipitation (ChIP) to identify transcription factors

    • Analyze chromatin structure at the PHO88 promoter using techniques similar to those used for PHO8

  • Post-transcriptional regulation assessment:

    • Measure mRNA stability using transcription inhibition and time-course analysis

    • Analyze protein stability with pulse-chase experiments (similar to methods used for Pho8 )

    • Investigate translational control using polysome profiling

  • Phosphate-responsive experimental design:

    • Establish clearly defined phosphate conditions:

      • High Pi: typically >10 mM phosphate

      • Low Pi: typically <0.2 mM phosphate

    • Include time-course analysis to capture early and late responses

    • Consider pH effects, as phosphate transport can be pH-dependent

  • Multiple levels of analysis:

    • Combine genomic, transcriptomic, and proteomic approaches

    • Integrate data using computational methods

  • Single-cell techniques:

    • Flow cytometry with fluorescent reporters

    • Microfluidics to control environmental conditions precisely

    • Single-cell RNA sequencing to capture cell-to-cell variation

For studying chromatin structure changes in response to phosphate, search result describes: "Digestion experiments with DNaseI, micrococcal nuclease and 20 different restriction nucleases show that under conditions of PHO8 repression, there is a highly ordered chromatin structure at the promoter."

How does PHO88 compare with phosphate transporters in other organisms?

PHO88 and related phosphate transport systems show interesting comparisons across species:

  • Comparison with other yeast phosphate transporters:

    • PHO89: A high-affinity Na⁺-dependent phosphate transporter active at alkaline pH (pH 9.5), with a Km for phosphate of 0.5 μM

    • PHO84: The major high-affinity Pi transporter, with Pho88 potentially involved in its maturation or trafficking

    • PHO86: Functionally related to PHO88, with similar membrane localization and effects on phosphate transport

  • Cross-species conservation:

    • PHO88 shows significant sequence homology with phosphate-related proteins in other fungi

    • Pho89 shows homology with Neurospora crassa Pho4 permease

    • Candida glabrata contains similar PHO pathway components, including PHO4, PHO80, PHO81, and PHO85

  • Functional conservation in phosphate signaling:

    • The core PHO signaling pathway (PHO81-PHO80/PHO85-PHO4) appears conserved across fungal species

    • In C. glabrata, "CgPho4 is likely regulated by the cyclin/CDK/CDK inhibitor complex Pho80/Pho85/Pho81"

  • Structural considerations:

    • Membrane topology and hydrophobicity profiles can be compared across species

    • Conservation of key functional domains suggests evolutionary importance

Understanding these relationships provides valuable context for interpreting PHO88 function and can inform experimental approaches through comparative analysis.

What insights can genomic and comparative analyses provide about PHO88 evolution and function?

Genomic and comparative analyses offer several insights into PHO88 evolution and function:

  • Sequence conservation analysis:

    • Identification of highly conserved domains suggests functional importance

    • Variable regions may indicate species-specific adaptations

    • Search result mentions extensive genetic diversity in S. cerevisiae, with "a total of 1,918,693 SNPs and 58,947 InDels detected across 3,034 isolates"

  • Phylogenetic relationships:

    • Evolutionary history of PHO88 across fungal species

    • Identification of potential gene duplication events

    • Correlation with environmental phosphate availability in natural habitats

  • Population genomics:

    • Analysis of natural variation in PHO88 across S. cerevisiae strains

    • Identification of potential adaptive mutations

    • From search result : "The population nucleotide diversity (median π = 3.6×10⁻³) is slightly increased from previous estimations"

  • Functional inference from related proteins:

    • SMP domain proteins like E-syt2 and Mdm12 show structural similarity to some membrane proteins

    • Membrane protein functions can be predicted based on conserved domains

  • Experimental validation of predictions:

    • Testing function of conserved residues through mutagenesis

    • Heterologous expression to test functional complementation

    • Domain swapping experiments between related proteins

These comparative approaches can generate testable hypotheses about PHO88 function and evolutionary significance within phosphate transport systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.