Recombinant Saccharomyces cerevisiae Iron-sulfur clusters transporter ATM1, mitochondrial (ATM1)

Shipped with Ice Packs
In Stock

Description

Functional Roles

ATM1 mediates the export of mitochondrial-synthesized Fe-S clusters and sulfur-containing intermediates:

  • Fe-S Cluster Export: Transports glutathione-coordinated [2Fe-2S] ([2Fe-2S]GS4_4) or [4Fe-4S] complexes to the cytosol for incorporation into apoproteins .

  • Heme Metabolism: Indirectly affects heme biosynthesis by regulating mitochondrial iron levels .

  • Pathogen Virulence: Orthologs in Cryptococcus neoformans and Plasmodium are essential for mitochondrial respiration and infectivity .

3.1. Substrate Specificity and Transport Mechanism

  • ATM1’s ATPase activity is stimulated by oxidized glutathione (GSSG) and Fe-S clusters, with KmK_m values of 0.8 mM (GSSG) and 2.5 µM ([4Fe-4S]) .

  • Structural studies reveal a "switch mechanism" where ATP hydrolysis drives conformational changes for substrate translocation .

3.2. Functional Complementation

  • S. cerevisiae ATM1 rescues Fe-S defects in Toxoplasma gondii and Plasmodium falciparum, confirming evolutionary conservation .

  • Partial complementation of C. neoformans ATM1 in yeast highlights species-specific adaptations .

3.3. Pathophysiological Implications

  • Iron Dysregulation: ATM1-deficient cells accumulate mitochondrial iron (30-fold increase) and show cytosolic iron depletion .

  • Oxidative Stress Sensitivity: Loss of ATM1 impairs catalase and superoxide dismutase activities, increasing ROS susceptibility .

Experimental Applications

Recombinant ATM1 is used in:

  • ATPase Activity Assays: Measure hydrolysis rates under varying GSSG/Fe-S conditions .

  • Proteoliposome Transport Studies: Quantify [2Fe-2S]GS4_4 flux using radiolabeled 55Fe^{55}\text{Fe} .

  • Structural Biology: Cryo-EM and X-ray crystallography to resolve transporter conformations .

Comparative Analysis of ATM1 Homologs

OrganismFunctionPhenotype of Knockout
S. cerevisiae (ATM1)Fe-S export, heme regulationLethal; mitochondrial iron overload
H. sapiens (ABCB7)Cytosolic Fe-S assemblyX-linked sideroblastic anemia with ataxia
P. falciparum (ATM1)Parasite Fe-S biogenesisNon-viable blood-stage parasites

Unresolved Questions

  • Exact Substrate Identity: Debate persists between [2Fe-2S]GS4_4 vs. sulfur-polysulfide-GSH complexes .

  • Regulatory Pathways: How cytosolic iron sensors (e.g., Aft1/2) modulate ATM1 expression remains unclear .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ATM1; MDY; YMR301C; YM9952.03C; Iron-sulfur clusters transporter ATM1, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
27-690
Protein Length
Full Length of Mature Protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
ATM1
Target Protein Sequence
SPVIFTVSKLSTQRPLLFNSAVNLWNQAQKDITHKKSVEQFSSAPKVKTQVKKTSKAPTL SELKILKDLFRYIWPKGNNKVRIRVLIALGLLISAKILNVQVPFFFKQTIDSMNIAWDDP TVALPAAIGLTILCYGVARFGSVLFGELRNAVFAKVAQNAIRTVSLQTFQHLMKLDLGWH LSRQTGGLTRAMDRGTKGISQVLTAMVFHIIPISFEISVVCGILTYQFGASFAAITFSTM LLYSIFTIKTTAWRTHFRRDANKADNKAASVALDSLINFEAVKYFNNEKYLADKYNGSLM NYRDSQIKVSQSLAFLNSGQNLIFTTALTAMMYMGCTGVIGGNLTVGDLVLINQLVFQLS VPLNFLGSVYRDLKQSLIDMETLFKLRKNEVKIKNAERPLMLPENVPYDITFENVTFGYH PDRKILKNASFTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDID ALRKVIGVVPQDTPLFNDTIWENVKFGRIDATDEEVITVVEKAQLAPLIKKLPQGFDTIV GERGLMISGGEKQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRDNFTSGSRTS VYIAHRLRTIADADKIIVLDNGRVREEGKHLELLAMPGSLYRELWTIQEDLDHLENELKD QQEL
Uniprot No.

Target Background

Function
ATM1 plays a crucial role in the generation of cytoplasmic iron-sulfur proteins. It facilitates the ATP-dependent export of Fe/S cluster precursors synthesized by NFS1 and other mitochondrial proteins. ATM1 also hydrolyzes ATP, binds glutathione, and may function by transporting a glutathione-conjugated iron-sulfur compound.
Gene References Into Functions
  1. The growth phenotype of atm3-1 was significantly enhanced by depletion of the mitochondrion-localized, GSH-dependent persulfide oxygenase ETHE1, suggesting that the physiological substrate of ATM3 contains persulfide in addition to glutathione. PMID: 25006243
  2. This study reports the crystal structures of free and glutathione-bound Atm1 in inward-facing, open conformations at 3.06- and 3.38-angstrom resolution, respectively. PMID: 24604199
  3. The physiological substrate of Atm1p may contain multiple sulfhydryl groups in a peptidic environment. PMID: 16754360
  4. Structural analysis of Atm1p by CD spectroscopy suggested a similarity of secondary structure to other members of the ABC protein family. PMID: 16963188
  5. Compared to wild-type mitochondria, iron-sulfur cluster and heme levels in Atm1p-depleted mitochondria from aerobic cells are diminished. Atm1p depletion causes a buildup of nonheme ferrous ions in mitochondria and an increase in oxidative damage. PMID: 19761223

Show More

Hide All

Database Links

KEGG: sce:YMR301C

STRING: 4932.YMR301C

Protein Families
ABC transporter superfamily, ABCB family, Heavy Metal importer (TC 3.A.1.210) subfamily
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the evolutionary significance of ATM1 across different species?

ATM1 represents a highly conserved family of ABC transporters present in virtually all eukaryotes. The ATM1 homolog (ScAtm1) in Saccharomyces cerevisiae is functionally similar to ABCB7 in humans, with both playing critical roles in Fe-S cluster export from mitochondria . Homologs have been identified across diverse species, including apicomplexan parasites like Plasmodium falciparum (PfATM1) and Toxoplasma gondii (TgATM1) . This conservation underscores the fundamental importance of this transporter in cellular metabolism across evolutionary boundaries.

Experimental approaches to study evolutionary conservation include:

  • Complementation assays (e.g., successful complementation of TgATM1 mutants with ScATM1)

  • Sequence homology analysis across species

  • Functional characterization of ATM1 homologs in different organisms

What cellular processes are impaired when ATM1 is knocked out or downregulated?

Disruption of ATM1 leads to several significant cellular defects:

PhenotypeOrganismExperimental MethodReference
Iron accumulation in mitochondriaS. cerevisiaeIron content measurement
Impaired maturation of cytosolic Fe-S proteinsS. cerevisiaeEnzyme activity assays
Defective tRNA thiolationS. cerevisiaeRNA analysis
Growth defectsVariousGrowth curve analysis
Lethality in blood stage developmentP. berghei, P. falciparumKnockout attempts

Methodologically, researchers typically employ conditional knockout systems, RNA interference, or CRISPR-Cas9 approaches to study ATM1 deficiency, as complete deletion is often lethal in many organisms . Phenotypic analyses include biochemical assays for Fe-S enzyme activities, iron quantification using spectroscopic methods, and transcriptional profiling.

What is the molecular structure of ATM1 and how does it influence function?

Recent cryo-electron microscopy studies of the Chaetomium thermophilum ATM1 homolog (CtAtm1) have revealed crucial structural insights at resolutions of 2.8-3.2 Å . The transporter consists of:

  • Two transmembrane domains spanning the mitochondrial inner membrane

  • Two nucleotide-binding domains facing the mitochondrial matrix

  • A substrate-binding cavity with positive charge distribution

The structure reveals a partial occlusion state that links cargo binding to residues at the mitochondrial matrix interface. This architecture allows ATM1 to accept glutathione-complexed iron-sulfur clusters and transport them across the membrane . Structural analysis methods include:

  • Cryo-electron microscopy

  • Molecular docking simulations

  • Structure-guided mutagenesis to validate functional residues

How do researchers differentiate between the mitochondrial transporter ATM1 and the DNA damage response protein Tel1 in experimental systems?

This question addresses a common source of confusion in yeast research. Despite similar abbreviations, ATM1 (iron-sulfur cluster transporter) and Tel1 (an ATM-related protein involved in DNA damage response) have distinct functions and cellular localizations:

FeatureATM1Tel1
Full nameATP-binding cassette transporter of mitochondria 1Telomere maintenance 1
Protein familyABC transporterPhosphatidylinositol 3-kinase-related kinase
Cellular locationMitochondrial inner membraneNucleus
Primary functionFe-S cluster exportDNA damage checkpoint control
Phenotype when deletedIron accumulation, defective cytosolic Fe-S proteinsShortened telomeres, checkpoint defects

Methodologically, researchers distinguish between these proteins through:

  • Subcellular fractionation followed by Western blotting

  • Fluorescence microscopy with tagged proteins

  • Functional assays: Fe-S enzyme activities (ATM1) vs. DNA damage response (Tel1)

  • Genetic complementation experiments

The study of Tel1 in S. cerevisiae has shown it plays a role in checkpoint responses to phleomycin treatment in S phase, working alongside Mec1 . When studying phenotypes related to DNA damage, researchers must be careful not to confuse Tel1-dependent phenotypes with those related to ATM1 dysfunction.

What methodologies are most effective for purifying functional recombinant ATM1 for biochemical studies?

Obtaining pure, functional recombinant ATM1 presents significant challenges due to its membrane-embedded nature. Researchers have developed several approaches:

  • Expression systems:

    • E. coli: Challenge due to toxicity and inclusion body formation

    • S. cerevisiae: Native environment but lower yields

    • Insect cells (Sf9, High Five): Higher yields with proper folding

    • Mammalian cells: Most native-like post-translational modifications

  • Purification strategies:

    • Detergent solubilization (commonly DDM, LMNG, or GDN)

    • Affinity chromatography using poly-histidine or other fusion tags

    • Size exclusion chromatography for final polishing

    • Reconstitution into nanodiscs or liposomes for functional studies

  • Activity verification methods:

    • ATPase assays measuring ATP hydrolysis (stimulated by oxidized glutathione and [4Fe-4S])

    • Transport assays using fluorescent or radioactive substrates

    • Binding assays with putative substrates (e.g., glutathione-complexed [Fe-S] clusters)

In recent studies, P. falciparum ATM1 (PfATM1) was successfully expressed and purified, demonstrating ATP hydrolysis activity that was stimulated by oxidized glutathione (GSSG) and [4Fe-4S] clusters . This confirms ATM1 as a functional ABC transporter capable of substrate-stimulated ATPase activity.

How does ATM1 interact with other components of the iron-sulfur cluster biogenesis machinery?

ATM1 functions as a critical link between mitochondrial Fe-S cluster assembly and cytosolic Fe-S protein maturation. Research has revealed several key interactions:

Interaction PartnerSubcellular LocationFunctional SignificanceDetection Method
Mitochondrial ISC scaffold proteinsMitochondrial matrixTransfer of [4Fe-4S] clusters to ATM1Co-immunoprecipitation, in vitro transfer assays
Glutathione (GSH/GSSG)UbiquitousForms complexes with Fe-S clusters for transportSubstrate stimulation of ATPase activity
CIA protein NBP35CytosolAccepts Fe-S clusters or intermediates from ATM1Protein-protein interaction studies

Methodologically, researchers investigate these interactions through:

  • Genetic epistasis analysis

  • Protein-protein interaction studies (yeast two-hybrid, co-immunoprecipitation)

  • In vitro reconstitution of Fe-S transfer

  • Structural studies of protein complexes

In P. falciparum, PfATM1 has been shown to receive [4Fe-4S] clusters from mitochondrial ISC scaffold proteins and interact with the cytosolic CIA protein PfNBP35 . This provides evidence for ATM1's role as a bridge in the Fe-S cluster transfer pathway from mitochondria to cytosolic proteins.

What explains the contradictory findings regarding ATM1 essentiality in different Plasmodium species?

Several methodological approaches can help resolve such contradictions:

  • Technical differences in gene deletion strategies:

    • Conditional vs. constitutive knockout approaches

    • Different gene editing efficiencies

    • Compensatory mutations in successful knockout lines

  • Genetic background variations:

    • Strain-specific differences in metabolic requirements

    • Presence of genetic modifiers in different laboratory strains

  • Environmental conditions:

    • In vitro vs. in vivo growth conditions

    • Media composition differences

    • Oxygen tension variations

  • Functional redundancy assessment:

    • Investigation of paralog expression and compensation

    • Comparative transcriptomics of wild-type vs. mutant lines

    • Metabolic profiling to identify alternative pathways

To resolve such contradictions, researchers should employ standardized methodologies across laboratories, including detailed reporting of experimental conditions, strain information, and comprehensive phenotypic characterization of mutant lines.

How does ATM1 transport mechanism differ from other mitochondrial ABC transporters?

ATM1 possesses distinct structural and functional features compared to other mitochondrial ABC transporters:

  • Substrate specificity:
    ATM1 preferentially transports glutathione-complexed iron-sulfur clusters, with its activity stimulated by oxidized glutathione (GSSG) . This contrasts with other mitochondrial ABC transporters that transport different substrates like peptides or metabolites.

  • Transport directionality:
    ATM1 exports substrates from the mitochondrial matrix to the intermembrane space, while some other transporters function in the opposite direction or bidirectionally.

  • Structural adaptations:
    The substrate-binding cavity of ATM1 contains positively charged residues that form a partially occluded state linking cargo binding to residues at the mitochondrial matrix interface . This specific architecture facilitates recognition of negatively charged glutathione-Fe-S complexes.

  • ATP utilization efficiency:
    Biochemical studies of PfATM1 demonstrate ATP hydrolysis activity specifically stimulated by physiological substrates (GSSG and [4Fe-4S]) , suggesting a tightly coupled transport mechanism.

Methodologically, these differences are studied through:

  • Comparative structural analysis

  • Substrate specificity assays

  • Site-directed mutagenesis of key residues

  • Transport kinetics measurements in reconstituted systems

Understanding these molecular differences provides insights into the specialized function of ATM1 in cellular iron-sulfur metabolism and may guide development of specific modulators for research applications.

What are the most reliable reporter systems to monitor ATM1 activity in vivo?

Monitoring ATM1 activity in living cells presents challenges due to the intracellular nature of its substrates. Several effective approaches have been developed:

  • Cytosolic Fe-S protein activity assays:

    • Measurement of cytosolic Fe-S enzymes (e.g., isopropylmalate isomerase, Leu1)

    • Aconitase activity assays

    • Xanthine oxidase activity

  • Iron homeostasis indicators:

    • Mitochondrial iron content quantification

    • Iron-responsive element (IRE) reporter systems

    • Transcriptional profiling of iron-responsive genes

  • Fluorescent substrate analogs:

    • Development of fluorescent glutathione derivatives

    • FRET-based sensors for conformational changes

  • Genetic reporter systems:

    • Linking ATM1 function to expression of fluorescent proteins via Fe-S-dependent transcription factors

    • Growth-based selection systems in complementation assays

These approaches provide complementary information, with enzyme activity assays being most directly related to ATM1 function, while iron content measurements offer insights into the consequences of ATM1 dysfunction.

How can researchers reconcile the dual roles of ATM and ATM1 signaling in experimental systems?

The potential confusion between ATM1 (the mitochondrial Fe-S transporter) and ATM (Ataxia Telangiectasia Mutated, a DNA damage response kinase) requires careful experimental design:

AspectATM1 (Transporter)ATM (Kinase)
FunctionIron-sulfur cluster exportDNA damage response signaling
Cellular locationMitochondrial membraneNucleus
Knockout phenotypeIron homeostasis defectsDNA damage sensitivity
Experimental readoutsFe-S enzyme activitiesH2AX phosphorylation, cell cycle checkpoints
InhibitorsNo specific inhibitors identifiedKU-55933, KU-60019

In experimental designs, researchers should:

  • Clearly define which protein is being studied

  • Use specific readouts that distinguish between the two pathways

  • Include appropriate controls (e.g., ATM inhibitors will not affect ATM1 function)

  • Consider the context of the experiment (DNA damage vs. mitochondrial function)

In the context of Saccharomyces cerevisiae, Tel1 (not ATM1) is the homolog of mammalian ATM, functioning in DNA damage checkpoint responses particularly after phleomycin treatment in S phase . This distinction is crucial for proper experimental interpretation.

What computational approaches are most effective for predicting ATM1 substrate recognition and transport kinetics?

Computational biology offers powerful tools for understanding ATM1 function:

  • Molecular docking and virtual screening:

    • Prediction of glutathione-Fe-S cluster binding modes

    • Identification of key interaction residues

    • Screening of potential modulators

  • Molecular dynamics simulations:

    • Analysis of conformational changes during transport cycle

    • Investigation of water and ion movements

    • Energetics of substrate translocation

  • Quantum mechanical/molecular mechanical (QM/MM) methods:

    • Electronic structure calculations for Fe-S clusters

    • Understanding the role of redox states in transport

  • Machine learning approaches:

    • Prediction of transport efficiency based on substrate properties

    • Classification of potential substrates from chemical libraries

These computational approaches should be validated through experimental testing, such as site-directed mutagenesis of predicted key residues and transport assays with modified substrates.

How do mutations in human ABCB7 (ATM1 homolog) contribute to X-linked sideroblastic anemia with ataxia?

X-linked sideroblastic anemia with ataxia (XLSA/A) is a rare disorder caused by mutations in ABCB7, the human homolog of yeast ATM1. Understanding the molecular basis through yeast models provides valuable insights:

  • Genotype-phenotype correlations:

    • Missense mutations in ABCB7 lead to partial function

    • Complete loss of function likely lethal (as in yeast)

    • Specific mutations affect ATPase activity or substrate binding

  • Disease mechanisms:

    • Impaired cytosolic Fe-S protein maturation

    • Mitochondrial iron overload

    • Defective heme biosynthesis

    • Compromised DNA repair (due to defective Fe-S cluster assembly in DNA repair enzymes)

  • Yeast models for human disease:

    • Expression of human ABCB7 variants in ATM1-deficient yeast

    • Functional complementation assays

    • Structure-function analysis of disease-associated mutations

This research direction connects fundamental studies in yeast to human disease mechanisms, providing potential therapeutic targets for XLSA/A.

How can ATM1 inhibition be exploited as a potential target in apicomplexan parasites?

The essentiality of ATM1 in certain apicomplexan parasites presents a therapeutic opportunity:

  • Target validation approaches:

    • Conditional knockdown systems to confirm essentiality

    • Phenotypic analysis of ATM1-depleted parasites

    • Genetic complementation with drug-resistant variants

  • High-throughput screening strategies:

    • ATPase activity inhibition assays

    • Growth inhibition assays in ATM1-downregulated parasites

    • Counterscreening against human ABCB7 for selectivity

  • Structure-based drug design:

    • Exploitation of structural differences between parasite and human ATM1

    • Virtual screening for binding site inhibitors

    • Fragment-based approaches targeting allosteric sites

  • Resistance mechanisms:

    • Poly(Asn) repeats in PfATM1 associated with differential drug susceptibility

    • Monitoring of resistance development in laboratory strains

    • Cross-resistance analysis with existing antimalarials

This research area represents a promising approach for developing new antiparasitic agents with novel mechanisms of action.

What technological advances would enable real-time monitoring of ATM1 transport activity in living cells?

Current limitations in visualizing ATM1 activity could be overcome through:

  • Advanced imaging approaches:

    • Development of fluorescent Fe-S cluster analogs

    • FRET-based sensors for ATM1 conformational changes

    • Super-resolution microscopy of labeled ATM1 and substrates

  • Biosensor development:

    • Genetically encoded sensors for cytosolic Fe-S cluster availability

    • Redox-sensitive fluorescent proteins

    • Split fluorescent protein systems linked to Fe-S protein maturation

  • Single-molecule techniques:

    • Optical tweezers to measure forces during transport

    • Single-molecule FRET to monitor conformational dynamics

    • High-speed AFM to visualize structural changes

  • Microfluidic approaches:

    • Real-time monitoring of cellular responses to ATM1 modulation

    • Single-cell analysis of Fe-S protein activities

    • Controlled gradients of iron availability

These technological advances would significantly enhance our understanding of ATM1 function in its native cellular environment.

How might synthetic biology approaches expand our understanding of ATM1 function?

Synthetic biology offers innovative strategies for ATM1 research:

  • Minimal systems reconstitution:

    • Bottom-up assembly of Fe-S cluster export machinery

    • Artificial membrane systems with purified components

    • Coupling to synthetic Fe-S protein maturation pathways

  • Protein engineering:

    • Creation of ATM1 variants with altered substrate specificity

    • Development of split-ATM1 systems for regulated activity

    • Fusion to orthogonal signaling domains for controlled activation

  • Synthetic genetic circuits:

    • Engineering feedback loops to regulate ATM1 expression

    • Creating genetic switches responsive to Fe-S cluster levels

    • Computational modeling of synthetic circuits integrated with ATM1 function

  • Cross-species hybrid systems:

    • Chimeric transporters combining domains from different species

    • Heterologous expression in optimized chassis organisms

    • Evolution-guided optimization of transport efficiency

These approaches would not only deepen our understanding of ATM1 function but could potentially lead to biotechnological applications leveraging its transport capabilities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.