Recombinant Saccharomyces cerevisiae Iron transporter FTH1 (FTH1)

Shipped with Ice Packs
In Stock

Description

Metabolic and Proteomic Impacts

Proteomic analysis revealed that FTH1 expression:

  • Induces cytosolic iron depletion, activating high-affinity iron transporters (FET3, FTR1) and stress-response proteins (e.g., heat-shock proteins) .

  • Represses folate metabolism and translation machinery, suggesting resource reallocation to iron sequestration .

  • Generates incomplete protein fragments (e.g., Idh1p, Pgk1p), indicating disrupted translation under iron scarcity .

Genetic Interactions

Recombinant FTH1 operates in parallel with:

  • The RIM101 pH pathway, influencing cell-wall stability .

  • DNA damage repair mechanisms, mediated through iron-dependent pathways .

Applications and Implications

  • Bioremediation: Enhanced iron tolerance supports industrial applications in high-iron environments .

  • Disease Modeling: FTH1’s role in mitigating oxidative stress informs studies on neurodegenerative diseases linked to iron dysregulation (e.g., Alzheimer’s) .

  • Metabolic Engineering: Coupling FTH1 with native regulators (e.g., CCC1) could optimize iron homeostasis for biofuel or pharmaceutical production .

Unresolved Questions

  • Does FTH1 directly interact with yeast iron transporters, or does it modulate their activity indirectly via iron buffering?

  • What transcriptional or post-translational mechanisms govern FTH1’s iron-release dynamics in yeast?

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you require a specific format, please indicate your preference in the order notes. We will then prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
FTH1; YBR207W; YBR1446; Iron transporter FTH1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-465
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
Target Protein Sequence
MAFEDYFSFQIFFIFLRESLEIVVIVSILLTIVKQGLSVEDDSPFEGSSSSAGLPSPNTN TNADSTTAFLQAGPSDGNAIGTSATAANNKSRPLNVEEEEEIYEYSNELRDQDRESDEHT ADNVKLYQKLKIQILAGGAFGLLLCMLIGGAFVSIFYHIGTDLWTLSEHYYEGVLSLVAS VIISVMGLFFLRMGKLREKFRVKLASIIYSKDNNLLGNKTQKGVKFSEKYSFFILPFITT LREGLEAVVFIGGIGIDQPLSSIPLSMVLATAISTVFGIFFFRYSSSLSLKICLVVATCF LYLIAAGLFSKGVWQLELQDYVNKCNGQDMSEVGNGPGSYDISRSVWHVNCCNGEKDGGW MIFTAIFGWTNSATVGSVISYNAYWLVLICALKLLMIEEKYGYIPYLPISWQKKRIMKRL SIAKASLDLKHHTSELNSSTSEPDSQRRSKDSSVPLIIDSSGSAN
Uniprot No.

Target Background

Function
FTH1, a high-affinity iron transporter, is likely involved in the transport of iron stored within vacuoles.
Database Links

KEGG: sce:YBR207W

STRING: 4932.YBR207W

Protein Families
Oxidase-dependent Fe transporter (OFeT) (TC 9.A.10.1) family
Subcellular Location
Vacuole membrane; Multi-pass membrane protein.

Q&A

What is FTH1 and how does it relate to yeast iron metabolism?

FTH1 (ferritin heavy polypeptide 1) is a key component of the ferritin complex, a multi-subunit iron storage protein that prevents oxidative stress-induced apoptosis in humans and many other organisms . Interestingly, while ferritins are widely distributed across Bacteria, Archaea, and Eukarya, they are conspicuously absent in most fungal species including Saccharomyces cerevisiae . This makes yeast an excellent model system for studying heterologously expressed human FTH1, as there is no endogenous ferritin that would complicate interpretation of results.

When expressed in yeast, human FTH1 forms the expected higher-order multi-subunit structures as confirmed by SDS-PAGE and electron microscopy analyses . Research has shown that FTH1 functions as a pro-survival protein when expressed in yeast, preventing cell death induced by various stressors including copper toxicity .

How does S. cerevisiae naturally regulate iron metabolism without ferritin?

S. cerevisiae employs a different iron regulatory system primarily centered around the transcription factor Aft1. In iron-deficient conditions, Aft1 is activated and translocates to the nucleus where it induces the expression of genes in the iron regulon . These genes coordinate increased iron uptake and remodel cellular metabolism to cope with low-iron conditions .

The Aft1-mediated iron regulatory pathway includes:

  • Activation of ferric reductases (FRE1, FRE2) that convert Fe³⁺ to Fe²⁺ at the plasma membrane

  • Induction of FET3, which encodes a copper-dependent membrane-associated oxidase required for ferrous iron uptake

  • Modulation of various other metabolic processes to adapt to iron limitation

In contrast to humans, yeast lacks ferritin for iron storage but has evolved this transcriptional regulatory system to tightly control iron acquisition based on cellular needs.

What is Rgi1p in yeast and how does it compare to human FTH1?

CharacteristicHuman FTH1Yeast Rgi1p
Higher-order structure formationForms multi-subunit structuresDoes not form higher-order structures
Iron storage capacitySignificant iron storageNo enhanced iron storage capacity
Iron toxicity resistanceProvides resistanceDoes not increase resistance
Pro-survival functionActs as a pro-survival proteinShows similar pro-survival properties
Response to iron stressPrevents oxidative damageCells lacking RGI1 are hypersensitive to iron

Despite not functioning as a true ferritin, Rgi1p appears to play a role in regulating yeast sensitivity to iron stress through a mechanism distinct from FTH1 .

What methodologies are used for expressing human FTH1 in S. cerevisiae?

Researchers employ several approaches for heterologous expression of human FTH1 in yeast:

  • Vector Selection: Expression vectors with yeast-compatible promoters (e.g., GAL1, ADH1) are typically used. These vectors often contain selectable markers (URA3, LEU2) for maintenance in auxotrophic yeast strains .

  • Transformation Protocols:

    • Lithium acetate transformation is commonly used for introducing FTH1-encoding plasmids

    • Lentiviral transduction systems have also been adapted for yeast when stable integration is preferred

  • Expression Verification:

    • Western blotting to confirm protein expression

    • qRT-PCR to verify mRNA levels

    • Electron microscopy to confirm multi-subunit structure formation

  • Functional Validation:

    • Assays measuring resistance to oxidative stress or iron toxicity

    • Cell viability assays under various stress conditions

When expressing human FTH1 in yeast, codon optimization may improve expression efficiency, though this was not specifically mentioned in the search results.

How can researchers measure the impact of FTH1 expression on iron homeostasis in yeast?

Several experimental approaches can be used to assess how FTH1 expression affects iron homeostasis in yeast:

  • Iron Uptake Assays:

    • Measure ⁵⁵Fe uptake rates in cells expressing FTH1 versus controls

    • Quantify ferric reductase activity using colorimetric assays with ferrozine

  • Iron Storage Capacity:

    • Atomic absorption spectroscopy to determine total cellular iron content

    • Prussian blue staining to visualize iron deposits within cells

  • Iron-Responsive Gene Expression:

    • qRT-PCR analysis of iron regulon genes (FRE1, FRE2, FET3)

    • RNA-seq and ribosome profiling to assess genome-wide transcriptional and translational changes

    • Monitor expression of iron transporters like TfR1 (Transferrin Receptor 1) and FPN (Ferroportin)

  • Stress Response Measurements:

    • Growth inhibition assays under high iron conditions

    • Cell survival studies under oxidative stress

    • Clonogenic assays to evaluate long-term effects on cell proliferation

What technical challenges must be addressed when studying recombinant FTH1 in yeast?

Several technical challenges require careful consideration:

  • Protein Expression Optimization:

    • Achieving proper expression levels without toxicity

    • Confirming correct multi-subunit assembly of the ferritin complex

    • Verifying subcellular localization of the expressed protein

  • Experimental Controls:

    • Including proper empty vector controls

    • Using iron chelators (e.g., deferasirox) or iron supplementation as positive/negative controls

    • Creating FTH1 silenced lines via shRNA for comparison studies

  • Distinguishing Direct vs. Indirect Effects:

    • Determining whether observed phenotypes are due to FTH1's iron storage function or other activities

    • Separating effects on iron metabolism from general stress responses

    • Creating iron-binding deficient FTH1 mutants as controls

  • Data Interpretation Considerations:

    • Accounting for possible interactions with endogenous iron regulatory systems

    • Considering potential differences between human and yeast cellular environments

    • Validating findings using multiple experimental approaches

How does FTH1 expression impact cell survival pathways in yeast?

Research has demonstrated that human FTH1 expressed in yeast functions as a pro-survival protein through several mechanisms:

  • Anti-apoptotic Activity: FTH1 suppresses the pro-apoptotic effects of murine Bax when co-expressed in yeast . This suggests FTH1 interferes with programmed cell death pathways independent of its iron storage function.

  • Metal Toxicity Protection: FTH1 expression prevents cell death induced by copper toxicity . This protective effect illustrates FTH1's broader role in metal homeostasis beyond iron regulation.

  • Oxidative Stress Resistance: By sequestering free iron, FTH1 likely reduces reactive oxygen species generation through the Fenton reaction, though this mechanism needs further investigation in the yeast system.

The pro-survival function of FTH1 in yeast provides a valuable model for studying how iron metabolism interfaces with cell death pathways across eukaryotes. Researchers can use this system to identify conserved mechanisms that link metal homeostasis to cellular survival.

How can yeast expressing FTH1 be used to study iron-related disease mechanisms?

The FTH1-expressing yeast system offers several advantages for modeling human disease mechanisms:

  • Cancer Research Applications:

    • Studies show that FTH1 expression levels correlate with radioresistance in cancer cell lines

    • FTH1 influences lipid droplet (LD) accumulation, which affects cancer cell survival after radiation

    • Yeast expressing FTH1 can model these relationships in a simplified genetic background

  • Pancreatic Cancer Models:

    • Research demonstrates that FTH1 expression correlates with pancreatic ductal adenocarcinoma (PDAC) progression

    • FTH1 influences proline metabolism through interaction with pyrroline-5-carboxylate reductase 1 (PYCR1)

    • Yeast models can isolate this relationship for mechanistic studies

  • Neurodegenerative Disease Relevance:

    • Iron dyshomeostasis is implicated in conditions like Alzheimer's and Parkinson's diseases

    • Yeast expressing FTH1 can model neuroprotective mechanisms against iron-induced oxidative stress

By manipulating FTH1 expression and iron availability in yeast, researchers can isolate specific pathways disrupted in human diseases while eliminating confounding variables present in more complex model systems.

What insights can be gained by comparing Aft1 and FTH1-mediated iron regulation?

Comparative analysis of Aft1 (yeast) and FTH1 (human) provides valuable insights into divergent evolutionary strategies for iron homeostasis:

  • Regulatory Mechanisms:

    • Aft1 functions primarily at the transcriptional level, activating genes in response to iron deficiency

    • FTH1 operates post-translationally by directly sequestering excess iron in a bioavailable form

  • Cellular Processes Affected:

    • Aft1 influences diverse cellular processes including cell-cycle progression, chromosome stability, DNA damage repair, and mitochondrial function

    • FTH1 primarily affects oxidative stress resistance, cell viability, and specific metabolic pathways

  • Response to Stress Conditions:

    • Aft1 activation occurs under various stress conditions including alkaline pH, DNA damage, diauxic shift, and mitochondrial dysfunction

    • FTH1 expression responds primarily to iron levels but also influences response to radiation and other stressors

This comparative approach reveals how different evolutionary solutions to iron regulation can impact cellular physiology in distinct ways, potentially informing therapeutic strategies for iron-related disorders.

How do researchers address the multifunctional nature of Aft1 beyond iron regulation?

Aft1's involvement in multiple cellular processes creates experimental challenges that researchers address through several strategies:

  • Genetic Interaction Networks:

    • Genome-wide synthetic lethal and synthetic dosage lethal screens have identified >70 deletion mutants sensitive to Aft1 level perturbations

    • These networks reveal Aft1's influence on diverse processes including the RIM101 pH pathway, cell-wall stability, and chromosome maintenance

  • Distinguishing Iron-Dependent vs. Independent Functions:

    • Comparative analysis of mutants sensitive to Aft1 perturbation versus those sensitive to iron fluctuations

    • Only a subset of Aft1-interacting mutants display sensitivity to extracellular iron or genetic interactions with iron regulon genes

  • Experimental Approaches:

    • Microarray transcriptional profiling to identify Aft1-regulated genes under various conditions

    • Directed studies examining specific processes like chromosome maintenance and benomyl resistance

    • Supplementation experiments to determine if iron addition can rescue phenotypes of Aft1 mutants

Research has demonstrated that Aft1's role in DNA damage repair is mediated through iron, while its functions in chromosome maintenance and benomyl resistance appear independent of iron regulation, potentially through non-transcriptional mechanisms .

What methodological considerations are crucial when studying iron-dependent translational regulation?

Studying translational regulation in response to iron availability requires careful experimental design:

  • Ribosome Profiling Approaches:

    • RNA-seq combined with ribosome profiling (Ribo-Seq) provides genome-wide quantitative measurement of translational changes during iron deficiency adaptation

    • This approach has revealed downregulation of genes involved in iron-dependent processes including mitochondrial translation and heme biosynthesis

  • RNA-Binding Protein Analysis:

    • Iron regulatory proteins like Cth1 and Cth2 mediate translational regulation in response to iron deficiency

    • Techniques to study these interactions include RNA immunoprecipitation and reporter gene assays

  • Ribosome Recycling Factor Assessment:

    • Iron deficiency affects global protein translation by decreasing the activity of ribosome recycling factor Rli1

    • Eliminating Cth1 and Cth2 increases Rli1 levels, indicating adaptive limitation of Rli1 activity under low iron conditions

  • Controls and Validation:

    • Iron chelators and supplementation to confirm iron-dependent effects

    • Genetic knockouts of key regulatory factors (e.g., Cth1/2, Aft1) to validate pathway components

    • Multiple timepoints to distinguish immediate versus adaptive responses

These methodological considerations ensure accurate characterization of the complex relationship between iron availability and translational regulation in yeast and potentially other eukaryotic systems.

What are the research implications of FTH1's interaction with lipid metabolism?

Recent research has uncovered an unexpected relationship between FTH1 and lipid metabolism with significant implications for future studies:

  • Lipid Droplet Regulation:

    • FTH1 expression levels directly correlate with lipid droplet (LD) content in cancer cells

    • FTH1 silencing results in significant reduction of LDs, which in turn increases radiosensitivity

    • This relationship appears to be reversible, with FTH1 overexpression in silenced cells restoring LD content and clonogenic response

  • Cytoplasmic Iron Pool Connection:

    • The link between FTH1 and LDs is connected to the free cytoplasmic iron pool

    • FTH1 silencing affects iron homeostasis genes like TfR1 (downregulated) and FPN (upregulated)

    • This suggests unbalanced intracellular iron availability affects lipid pathways, particularly LD accumulation

  • Research Approaches:

    • Lipidomic analysis of yeast expressing FTH1 versus controls

    • Investigation of lipid biosynthesis gene expression in FTH1-expressing yeast

    • Microscopic visualization of lipid droplets in relation to FTH1 expression

    • Analysis of iron-lipid relationships under various stress conditions

This emerging area suggests a previously unappreciated connection between iron metabolism and lipid homeostasis that could have implications for understanding metabolic adaptations in cancer and other diseases.

What controls are essential when studying recombinant FTH1 in yeast?

Proper experimental controls are crucial for interpreting FTH1 studies in yeast:

  • Vector Controls:

    • Empty vector controls (e.g., Scr and Void) to account for effects of the expression system itself

    • Vector expressing an unrelated protein of similar size to control for protein expression burden

  • Iron Status Controls:

    • Iron supplementation conditions to test iron-dependent effects

    • Iron chelation (e.g., with deferasirox) to create iron-limited conditions

    • Time course studies to distinguish acute versus chronic responses

  • FTH1 Variant Controls:

    • Iron-binding deficient FTH1 mutants to separate iron storage from other functions

    • FTH1 overexpression in silenced cell lines to confirm reversibility of phenotypes

    • FTL (ferritin light chain) expression to examine subunit-specific effects

  • Genetic Background Controls:

    • Testing in multiple yeast strains to ensure robustness of observations

    • Using strains with mutations in endogenous iron regulatory pathways (e.g., aft1Δ)

    • Confirming key findings in mammalian cell lines for translational relevance

Careful implementation of these controls helps distinguish direct effects of FTH1 from indirect or strain-specific phenomena.

How can researchers verify proper FTH1 multi-subunit structure formation in yeast?

Confirming correct assembly of FTH1 into functional multi-subunit structures requires multiple analytical approaches:

  • Biochemical Analysis:

    • Native gel electrophoresis to detect high molecular weight complexes

    • Size exclusion chromatography to separate assembled complexes from monomers

    • SDS-PAGE analysis under non-reducing conditions

  • Microscopy Techniques:

    • Electron microscopy to directly visualize the characteristic spherical structure of ferritin complexes

    • Immunofluorescence microscopy with anti-FTH1 antibodies to determine subcellular localization

  • Functional Assays:

    • Iron incorporation assays using radioactive or colorimetric detection

    • Protection against iron-induced oxidative damage

    • Ferritin-specific activity assays

Research has confirmed that human FTH1 expressed in yeast forms the expected higher-order structures while the yeast Rgi1p, despite sequence similarity, does not assemble into similar complexes . This structural difference correlates with functional divergence in iron storage capacity.

What methodologies help distinguish between transcriptional and translational effects in iron metabolism studies?

Separating transcriptional from translational regulation requires specialized experimental approaches:

  • Combined RNA-seq and Ribosome Profiling:

    • RNA-seq measures mRNA abundance (transcriptional effects)

    • Ribosome profiling (Ribo-Seq) quantifies ribosome-protected fragments to assess translation

    • Comparing these datasets reveals genes regulated primarily at the translational level

  • Reporter Assays:

    • Construct reporters with iron-responsive elements under constitutive promoters

    • Separate promoter activity from post-transcriptional regulation

    • Mutational analysis of regulatory elements

  • Polysome Profiling:

    • Fractionate ribosomes based on the number of associated ribosomes

    • Analyze mRNA distribution across polysome fractions

    • Identify changes in translation efficiency independent of mRNA levels

  • Protein Synthesis Measurements:

    • Metabolic labeling with radioactive amino acids or non-canonical amino acids

    • Pulse-chase experiments to distinguish synthesis from degradation

    • Targeted mass spectrometry to quantify protein production rates

Research employing these approaches has revealed that iron deficiency affects translational regulation of specific gene sets, including those involved in iron-dependent processes like mitochondrial translation and heme biosynthesis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.