Recombinant Saccharomyces cerevisiae J domain-containing protein 1 (JID1)

Shipped with Ice Packs
In Stock

Description

Functional Role in Cellular Processes

JID1 belongs to the J-protein family, which modulates Hsp70 activity in protein folding, translocation, and degradation. Key findings include:

Mitochondrial Localization and Function

  • Localization: Confined to the mitochondrial matrix, similar to Pam18 and Mdj2 .

  • Role: Likely involved in mitochondrial protein import or folding via interaction with mitochondrial Hsp70 (Ssc1) .

  • Exclusion from ERAD: Unlike ER-associated J-proteins (e.g., Scj1), JID1 cannot participate in endoplasmic reticulum-associated degradation due to its mitochondrial sequestration .

J-Protein Classification

JID1 is classified as a type II J-protein (lacking the zinc-finger domain present in type I J-proteins like Ydj1 or Scj1) . This distinction limits its substrate-binding capacity compared to type I J-proteins but retains the ability to stimulate Hsp70 ATPase activity.

Production and Purification

Recombinant JID1 is produced via bacterial expression systems, optimized for yield and solubility:

Production ParameterDetails
Expression VectorNot specified in available data; typically plasmid-based systems .
YieldNot explicitly quantified; purity >90% indicates efficient expression .
PurificationAffinity chromatography via His tag .
StabilityGlycerol addition (5–50%) enhances long-term stability .

Critical Notes:

  • Reconstitution: Avoid repeated freeze-thaw cycles; store working aliquots at 4°C for short-term use .

  • Expression Host Variability: While JID1 is produced in E. coli, other yeast proteins are often expressed in S. cerevisiae using vectors like CPOTud for higher yields .

Key Studies

  • Mitochondrial Matrix Function: JID1’s confinement to mitochondria excludes it from ERAD processes, contrasting with ER-localized J-proteins .

  • Hsp70 Interaction: Likely stimulates mitochondrial Hsp70 (Ssc1) ATPase activity, facilitating protein import into the matrix .

  • Structural Insights: The J-domain (aa 1–70) is critical for Hsp70 binding, while the C-terminal region (aa 71–301) may mediate substrate interaction .

Comparative Analysis with Other J-Proteins

J-ProteinLocalizationHsp70 PartnerFunction
JID1Mitochondrial matrixSsc1Protein import/folding
Scj1ER lumenKar2ERAD regulation
Ydj1CytosolSsa1/2Cytosolic protein folding

Data Tables and References

Table 2: Functional Comparison of J-Proteins

ProteinLocalizationHsp70 PartnerPrimary Role
JID1MitochondriaSsc1Mitochondrial protein folding
Scj1ER lumenKar2ERAD substrate binding
Ydj1CytosolSsa1/2Cytosolic protein refolding

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
JID1; YPR061C; J domain-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-301
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
JID1
Target Protein Sequence
MLHHKFVYPFLFKWHLSCVEKCPPQITFIAKYATANDKNGNRKLTIRDEQWPELADPTPY DIFGIPKAGSGNPKLDKKSLKKKYHRYVKLYHPDHSDNIQIFSSEKVTNSDSKSPLLLTS SEKLHRFKVISQAYDILCDPKKKIVYDTTRQGWTTSYSPRSNVNTENYQYAGSYGYHSNA QYEYWNAGTWEDANSMKNERIQENINPWTVIGIICGLAICIEGTALLAKIQESLSKAEFT HDESGLHLIQSYTNYGLDTDKFSRLRRFLWFRTWGLYKSKEDLDREAKINEEMIRKLKAA K
Uniprot No.

Target Background

Function
Probable chaperone.
Gene References Into Functions
  1. Studies indicate that Jid1 is confined to the mitochondrial matrix, precluding direct involvement in ERAD regulation. PMID: 19682992
Database Links

KEGG: sce:YPR061C

STRING: 4932.YPR061C

Protein Families
DnaJ family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is the structural organization of JID1's J-domain and how does it compare to other yeast J-proteins?

The J-domain of JID1, like other J-domain proteins in Saccharomyces cerevisiae, consists of approximately 70 amino acids arranged in four helices with a loop between helices 2 and 3 containing the highly conserved histidine-proline-aspartate (HPD) motif. This motif is critical for stimulating the ATPase activity of Hsp70 partner proteins . Unlike type I J-proteins such as Ydj1, JID1 is classified as a type III J-protein, meaning its J-domain can be located anywhere within the protein rather than exclusively at the N-terminus . The specific structural features that distinguish JID1 from other yeast J-proteins remain an area of active investigation.

What is the cellular localization of JID1 and how does it contribute to its function?

JID1 is one of the 22 J-proteins identified in S. cerevisiae. Based on current classification systems, JID1 appears to be among the five J-proteins associated with mitochondria, though its precise submitochondrial localization requires further characterization . This localization suggests JID1 may participate in mitochondrial protein quality control, possibly in cooperation with mitochondrial Hsp70 systems. Researchers investigating JID1 localization should employ fluorescence microscopy with GFP-tagged constructs alongside mitochondrial markers to confirm its precise distribution.

What specific Hsp70 partners does JID1 interact with in yeast cells?

While the search results don't specifically detail JID1's Hsp70 partners, the general mechanism of J-proteins involves interaction with Hsp70 chaperones through the conserved HPD motif in the J-domain. In S. cerevisiae, JID1 likely interacts with specific Hsp70 family members, possibly including mitochondrial Hsp70s if its mitochondrial localization is confirmed . Researchers should perform co-immunoprecipitation experiments coupled with mass spectrometry to identify JID1's specific Hsp70 partners, similar to approaches used for studying Ydj1-Ssa1 interactions .

What are the optimal conditions for recombinant expression and purification of JID1?

For recombinant expression of S. cerevisiae JID1, an E. coli expression system using a C-terminally His-tagged construct is recommended, similar to methods used for other J-proteins like Ydj1 . Expression should be conducted at lower temperatures (16-18°C) to enhance proper folding. Purification typically involves nickel affinity chromatography followed by size exclusion chromatography to obtain pure protein.

A standard purification protocol would include:

  • Cell lysis in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, and protease inhibitors

  • Ni-NTA affinity chromatography with step gradient elution (50-250 mM imidazole)

  • Size exclusion chromatography using Superdex 200 in 20 mM HEPES pH 7.5, 150 mM NaCl, 1 mM DTT

  • Concentration of pure protein using centrifugal filters with appropriate molecular weight cutoff

Researchers should verify protein quality by SDS-PAGE and assess proper folding through circular dichroism spectroscopy.

How can I design effective site-directed mutagenesis experiments to study JID1's functional domains?

When designing site-directed mutagenesis experiments for JID1:

  • Target the conserved HPD motif in the J-domain by mutating H to Q to abolish Hsp70 ATPase stimulation

  • Identify potential acetylation sites within the J-domain, similar to the six sites (K23, K24, K32, K37, K46, K48) found in Ydj1

  • Create lysine-to-arginine (K→R) mutations to prevent acetylation or lysine-to-glutamine (K→Q) mutations to mimic constitutive acetylation

  • Generate truncation constructs to determine the minimal functional units of JID1

For functional assessment of mutants, compare their ability to:

  • Stimulate ATPase activity of partner Hsp70s in vitro

  • Complement growth defects in JID1 deletion strains under stress conditions

  • Maintain proper protein-protein interactions using co-immunoprecipitation approaches

What methods are most effective for studying JID1's interaction with client proteins?

To study JID1's interactions with client proteins:

  • Crosslinking mass spectrometry (XL-MS) can identify direct binding interfaces between JID1 and clients

  • Pull-down assays using recombinant JID1 as bait can identify potential client proteins from yeast lysates

  • Fluorescence-based binding assays can determine binding affinities to model misfolded substrates

  • For in vivo studies, implement proximity-based labeling techniques such as BioID or APEX2 fused to JID1

When analyzing potential client interactions, it's important to distinguish between direct clients and indirect interactions mediated through Hsp70. Control experiments should include J-domain mutants defective in Hsp70 interaction to differentiate between these scenarios.

How does JID1 contribute to the recognition of misfolded proteins in yeast?

JID1 likely participates in the recognition of misfolded proteins through its client-binding domains, potentially working in conjunction with the Hsp70 system. Current evidence regarding similar J-proteins suggests JID1 may recognize specific features of misfolded proteins and deliver them to appropriate Hsp70 chaperones for refolding or degradation .

Like other J-proteins, JID1 may function to:

  • Initially recognize misfolded protein substrates

  • Deliver these substrates to Hsp70

  • Stimulate Hsp70's ATPase activity via its J-domain HPD motif

  • Facilitate substrate transfer to downstream quality control pathways

Researchers investigating JID1's role in misfolded protein recognition should employ aggregation-prone model substrates tagged with fluorescent reporters to track their fate in wild-type versus JID1-deletion strains.

What is the specific role of JID1 in ERAD (ER-Associated Degradation) compared to other J-proteins?

Current evidence suggests that various J-proteins in yeast have specialized roles in ERAD, with some being required for the degradation of specific substrates. While cytosolic J-proteins such as Ydj1 and Hlj1 are involved in the degradation of membrane ERAD substrates, the specific contribution of JID1 to ERAD pathways needs further investigation .

To determine JID1's role in ERAD:

  • Compare degradation kinetics of known ERAD substrates (like CPY* or α-mating factor) in wild-type versus JID1-deletion strains

  • Assess ubiquitination levels of ERAD substrates in the presence and absence of JID1

  • Determine whether JID1 physically interacts with components of the ERAD machinery

  • Investigate potential functional redundancy between JID1 and other J-proteins in ERAD pathways

How does the loss of JID1 affect cellular stress responses, particularly under conditions of proteotoxic stress?

To determine how JID1 loss affects cellular stress responses:

  • Compare growth rates of wild-type and JID1-deletion strains under various stressors:

    • Heat shock (37-39°C)

    • ER stress inducers (tunicamycin, DTT)

    • Oxidative stress (hydrogen peroxide)

    • Protein misfolding agents (AZC, ethanol)

  • Assess activation of stress response pathways:

    • Measure UPR induction using reporters for Hac1 splicing

    • Quantify heat shock response using HSE-reporter constructs

    • Analyze transcriptional changes using RNA-seq

  • Examine aggregation profiles:

    • Use differential centrifugation to quantify protein aggregation

    • Employ fluorescence microscopy to visualize aggregation patterns of model substrates

What post-translational modifications regulate JID1 function and how can they be experimentally characterized?

Based on studies of other J-proteins like Ydj1, lysine acetylation may be a significant post-translational modification affecting JID1 function. In Ydj1, six acetylation sites (K23, K24, K32, K37, K46, K48) have been identified in the J-domain, with acetylation affecting interactions with partner proteins .

To characterize potential PTMs on JID1:

  • Mass spectrometry analysis:

    • Purify recombinant or endogenously-tagged JID1 from yeast

    • Perform tryptic digestion followed by LC-MS/MS

    • Use neutral loss scanning to detect phosphorylation and acetylation sites

  • Functional analysis of identified PTM sites:

    • Generate non-modifiable (K→R) and modification-mimicking (K→Q for acetylation) mutants

    • Compare their impacts on:
      a. Interaction with Hsp70 partners using co-immunoprecipitation
      b. Client binding using in vitro assays
      c. ATPase stimulation of partner Hsp70s

  • Determine conditions that regulate these modifications:

    • Analyze PTM patterns under different stress conditions

    • Identify enzymes responsible for adding/removing modifications

How does J-domain acetylation impact JID1's interactions with partner proteins?

While specific information about JID1 acetylation is not provided in the search results, insights can be drawn from studies on Ydj1. In Ydj1, J-domain acetylation significantly impacts interactions with partner proteins. Proteomic analysis revealed that preventing acetylation (K→R mutations) increased Ydj1's interaction with the Hsp70 chaperone Ssa1, while mimicking constitutive acetylation (K→Q mutations) almost completely abolished this interaction .

For JID1, researchers should:

  • Identify acetylation sites within JID1's J-domain through mass spectrometry

  • Generate acetylation-deficient and acetylation-mimicking mutants

  • Compare interaction profiles of these mutants using:

    • Co-immunoprecipitation followed by Western blotting

    • Quantitative proteomics of immunoprecipitated complexes

    • In vitro binding assays with purified components

The resulting data would reveal whether JID1's interactions are similarly regulated by acetylation, potentially affecting its chaperone function and client specificity.

How does JID1 function differ from more well-characterized J-proteins like Ydj1 in S. cerevisiae?

Ydj1 is a type I J-protein with an N-terminal J-domain followed by a G/F-rich region and zinc-finger domains that aid in client binding . In contrast, JID1 is classified as a type III J-protein, with different domain organization and potentially different client specificity .

Key functional differences likely include:

  • Cellular localization: Ydj1 is primarily cytosolic and partially ER-associated, while JID1 appears to have mitochondrial associations

  • Client specificity: The different domain architectures suggest distinct client preferences

  • Partner Hsp70s: Ydj1 interacts primarily with cytosolic Ssa proteins, while JID1 likely interacts with different Hsp70 partners based on its localization

  • Functional redundancy: Ydj1 has partial functional overlap with Hlj1, while JID1's redundancy with other J-proteins remains to be characterized

To experimentally compare these proteins:

  • Perform complementation experiments to determine if JID1 overexpression can rescue Ydj1 deletion phenotypes

  • Compare client binding profiles using proteomics approaches

  • Analyze differences in stress response activation between deletion strains

What experimental approaches can distinguish the specific functions of JID1 from the 21 other J-proteins in yeast?

To distinguish JID1's specific functions:

  • Generate combinatorial deletion strains:

    • Create single, double, and triple deletions of JID1 with functionally related J-proteins

    • Analyze synthetic genetic interactions to identify functional overlap

  • Perform domain-swapping experiments:

    • Replace JID1's J-domain with J-domains from other J-proteins

    • Test whether the chimeric proteins can complement JID1 deletion phenotypes

  • Client specificity profiling:

    • Use crosslinking mass spectrometry to identify direct client interactions

    • Compare client profiles of JID1 versus other J-proteins

  • Localization-based function analysis:

    • Create mislocalized variants of JID1 (e.g., adding nuclear localization signals)

    • Determine whether properly localized JID1 is required for its function

  • Transcriptomic and proteomic profiling:

    • Compare gene expression and protein abundance changes in JID1 versus other J-protein deletion strains

    • Identify pathways specifically affected by JID1 loss

How can high-throughput screening approaches be optimized to identify small molecule modulators of JID1 function?

To establish a high-throughput screening platform for JID1 modulators:

  • Develop primary screening assays:

    • Fluorescence polarization assay measuring JID1-Hsp70 interaction

    • FRET-based assay monitoring conformational changes upon binding

    • ATPase stimulation assay measuring JID1's ability to stimulate Hsp70 ATPase activity

  • Design yeast-based reporter systems:

    • Engineer yeast strains where growth depends on functional JID1

    • Create fluorescent reporters that respond to JID1-dependent protein quality control

  • Establish counter-screening assays:

    • Test hits against other J-proteins to ensure specificity

    • Evaluate cytotoxicity in yeast and mammalian cells

    • Assess effects on global protein homeostasis

  • Data analysis and hit validation:

    • Apply machine learning algorithms to identify structural features of active compounds

    • Validate hits through secondary biochemical and cellular assays

    • Determine structure-activity relationships through analog testing

What are the optimal conditions for structural characterization of JID1 using X-ray crystallography or cryo-EM?

For structural characterization of JID1:

  • Sample preparation for X-ray crystallography:

    • Express and purify JID1 to >95% homogeneity with final concentration >10 mg/ml

    • Screen crystallization conditions using sparse matrix approach

    • Optimize promising conditions by varying pH, temperature, and precipitant concentration

    • Consider surface entropy reduction mutations to promote crystal packing

  • Sample preparation for cryo-EM:

    • If JID1 is too small for direct cryo-EM (~25-30 kDa), consider:
      a. Studying JID1 in complex with its Hsp70 partner
      b. Using antibody fragments to increase molecular weight

    • Prepare grids with protein concentration of 0.5-5 mg/ml

    • Test multiple grid types and freezing conditions

  • Complementary structural approaches:

    • NMR spectroscopy for dynamic regions

    • SAXS for solution structure and conformational ensemble

    • HDX-MS to map binding interfaces with partners

  • Co-crystallization strategies:

    • Attempt crystallization with client peptides

    • Co-crystallize with partner Hsp70 in different nucleotide states

    • Use nanobodies to stabilize specific conformations

How can contradictory results in JID1 functional studies be reconciled and what controls are essential?

When encountering contradictory results in JID1 studies:

  • Consider strain background effects:

    • Different yeast genetic backgrounds may show varying phenotypes

    • Always include isogenic controls

    • Test in multiple strain backgrounds to ensure robustness

  • Expression level considerations:

    • Both overexpression and endogenous expression studies should be performed

    • Quantify JID1 expression levels in each experiment

    • Use tunable promoters to determine threshold levels for function

  • Essential controls for JID1 functional studies:

    • J-domain mutants (HPD→QPD) as negative controls for Hsp70 interaction

    • Empty vector and wild-type JID1 complementation controls

    • Positive controls using well-characterized J-proteins

    • Tests for potential off-target effects of tagging strategies

  • Reconciliation strategies:

    • Carefully document experimental conditions that lead to different outcomes

    • Directly test hypothesized context-dependencies

    • Consider that JID1 may have different functions under different conditions

What are common pitfalls in recombinant JID1 expression and how can they be addressed?

Common pitfalls in recombinant JID1 expression include:

  • Protein insolubility:

    • Lower expression temperature to 16-18°C

    • Co-express with chaperones

    • Use solubility-enhancing fusion tags (MBP, SUMO)

    • Optimize lysis buffer conditions (add detergents, adjust salt concentration)

  • Proteolytic degradation:

    • Include protease inhibitors in all buffers

    • Consider removing flexible regions prone to proteolysis

    • Similar to Ydj1, watch for "delta J" fragments lacking the J-domain

    • Use protease-deficient expression strains

  • Low yield:

    • Optimize codon usage for expression host

    • Test different promoter systems

    • Consider auto-induction media

    • Scale up culture volume or increase cell density

  • Protein misfolding:

    • Verify proper folding using circular dichroism

    • Test functionality in simplified assays

    • Consider refolding from inclusion bodies if necessary

    • Add stabilizing agents to purification buffers

How should researchers interpret differences in JID1 activity between in vitro and in vivo experimental systems?

When faced with discrepancies between in vitro and in vivo JID1 results:

  • Consider post-translational modifications:

    • In vitro systems may lack relevant PTMs like acetylation that occur in vivo

    • Compare protein from recombinant sources versus that purified from yeast

    • Use mass spectrometry to identify differences in modification state

  • Account for missing cofactors and partners:

    • In vitro systems may lack important interaction partners

    • Supplement in vitro reactions with cellular extracts

    • Reconstitute with purified partner proteins

  • Address differences in protein concentration:

    • Local concentrations in cellular compartments may differ from in vitro conditions

    • Perform in vitro experiments across a range of concentrations

    • Use microscale thermophoresis or similar techniques to determine actual binding affinities

  • Reconciliation strategies:

    • Design hybrid approaches (e.g., add recombinant JID1 to cell extracts)

    • Engineer minimal cellular systems that recapitulate key aspects of JID1 function

    • Use structural analysis to identify potential reasons for functional differences

What emerging technologies might advance our understanding of JID1's role in protein quality control networks?

Emerging technologies that could advance JID1 research include:

  • Single-molecule techniques:

    • FRET to monitor JID1-client and JID1-Hsp70 interactions in real-time

    • Optical tweezers to measure forces involved in protein folding mediated by JID1

    • Super-resolution microscopy to visualize JID1's subcellular distribution at nanoscale resolution

  • Proteomics advances:

    • Proximity labeling (BioID, APEX) to map JID1's interaction network in vivo

    • Crosslinking mass spectrometry to identify direct binding interfaces

    • Thermal proteome profiling to identify substrates stabilized by JID1

  • CRISPR-based approaches:

    • CRISPRi for tunable repression of JID1 expression

    • CRISPR activation for controlled upregulation

    • Base editing for introducing specific mutations at the endogenous locus

  • Systems biology integration:

    • Network analysis combining genetic, physical, and functional interaction data

    • Mathematical modeling of chaperone networks including JID1

    • Multi-omics data integration to place JID1 in broader cellular context

How might understanding JID1 function contribute to therapeutic strategies for protein misfolding diseases?

While direct therapeutic applications would require further research bridging yeast and human systems, insights from JID1 could contribute to therapeutic approaches for protein misfolding diseases through:

  • Target identification:

    • Human homologs of JID1 might serve as therapeutic targets

    • Understanding mechanisms of chaperone specificity could inform drug design

    • Identifying key regulatory modifications like acetylation could reveal intervention points

  • Screening platforms:

    • Yeast models expressing disease-associated misfolded proteins and JID1 variants

    • High-throughput screens for compounds that modulate J-protein activity

    • Identification of small molecules that enhance protein quality control

  • Rational drug design:

    • Structure-based design of molecules that enhance JID1-like protein function

    • Development of peptide mimetics that recapitulate key functional domains

    • Design of allosteric modulators that enhance chaperone collaboration

  • Gene therapy approaches:

    • Potential overexpression of optimized J-proteins in affected tissues

    • Correction of mutations in human JID1 homologs

    • Targeted protein degradation approaches informed by JID1 mechanism studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.