Recombinant Saccharomyces cerevisiae Lanosterol 14-alpha demethylase (ERG11)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ERG11; CYP51; YHR007CLanosterol 14-alpha demethylase; EC 1.14.14.154; CYPLI; Cytochrome P450 51; Cytochrome P450-14DM; Cytochrome P450-LIA1; Sterol 14-alpha demethylase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-530
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
ERG11
Target Protein Sequence
MSATKSIVGEALEYVNIGLSHFLALPLAQRISLIIIIPFIYNIVWQLLYSLRKDRPPLVFYWIPWVGSAVVYGMKPYEFFEECQKKYGDIFSFVLLGRVMTVYLGPKGHEFVFNAKLADVSAEAAYAHLTTPVFGKGVIYDCPNSRLMEQKKFVKGALTKEAFKSYVPLIAEEVYKYFRDSKNFRLNERTTGTIDVMVTQPEMTIFTASRSLLGKEMRAKLDTDFAYLYSDLDKGFTPINFVFPNLPLEHYRKRDHAQKAISGTYMSLIKERRKNNDIQDRDLIDSLMKNSTYKDGVKMTDQEIANLLIGVLMGGQHTSAATSAWILLHLAERPDVQQELYEEQMRVLDGGKKELTYDLLQEMPLLNQTIKETLRMHHPLHSLFRKVMKDMHVPNTSYVIPAGYHVLVSPGYTHLRDEYFPNAHQFNIHRWNKDSASSYSVGEEVDYGFGAISKGVSSPYLPFGGGRHRCIGEHFAYCQLGVLMSIFIRTLKWHYPEGKTVPPPDFTSMVTLPTGPAKIIWEKRNPEQKI
Uniprot No.

Target Background

Function
This recombinant Saccharomyces cerevisiae Lanosterol 14-alpha demethylase (ERG11) catalyzes the C14-demethylation of lanosterol, a crucial step in ergosterol biosynthesis. Specifically, it converts lanosterol to 4,4'-dimethyl cholesta-8,14,24-triene-3-beta-ol.
Gene References Into Functions
  1. Molecular characterization of Erg11, including interactions with NADPH-cytochrome P450 reductase and its role in antifungal resistance [REVIEW]. PMID: 22217856
Database Links

KEGG: sce:YHR007C

STRING: 4932.YHR007C

Protein Families
Cytochrome P450 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the function of Lanosterol 14-alpha demethylase (ERG11) in Saccharomyces cerevisiae?

Lanosterol 14-alpha demethylase, encoded by the ERG11 gene, plays a critical role in ergosterol biosynthesis in Saccharomyces cerevisiae. It is the enzyme responsible for the demethylation of lanosterol, a key intermediate in the ergosterol biosynthetic pathway. There is only one sterol 14α-demethylases gene (ERG11) in the S. cerevisiae genome, unlike some other fungal species that may have multiple paralogs . Ergosterol is an essential component of fungal cell membranes that regulates membrane fluidity and permeability. The enzyme is particularly important during active growth phases when membrane synthesis is required, and its activity directly correlates with ergosterol production rates.

The function of ERG11 is highly conserved across fungal species, though with some variations in regulation and activity. In S. cerevisiae, deficiency in ERG11 function results in ergosterol depletion, which significantly impairs membrane integrity and cellular functions. Studies have shown that ERG11 is essential for normal growth in S. cerevisiae, as evidenced by the temperature-sensitive lethality of erg11 mutants at 37°C . The critical nature of this enzyme makes it an important target for antifungal drugs, particularly azoles, which inhibit its activity.

How is ERG11 expression regulated in S. cerevisiae?

ERG11 expression in S. cerevisiae is regulated by multiple factors and mechanisms that respond to cellular sterol levels and environmental conditions. The promoter region of ERG11 contains Sterol Regulatory Elements (SREs) that play a crucial role in its transcriptional regulation . These SREs are binding sites for transcription factors that respond to sterol depletion within the cell. When ergosterol levels decrease, these transcription factors activate ERG11 expression to restore normal sterol synthesis.

The regulation of ERG11 also shows significant variation depending on the growth state of the culture . Expression levels change during different growth phases, with particular patterns observed during logarithmic growth versus post-diauxic shift. When cells are treated with azole antifungal drugs, which inhibit ERG11 activity, there is a compensatory increase in ERG11 expression. Interestingly, this induction is not immediate but occurs primarily after the diauxic shift, suggesting a delayed regulatory response . This delayed transcriptional upregulation appears to be a response to gradual sterol depletion within the cells rather than a direct response to the presence of inhibitors .

Environmental factors such as carbon source, pH, and oxygen availability also significantly influence ERG11 expression. Studies have demonstrated that growth under anaerobic conditions alters the regulatory pattern of ERG11, reflecting the oxygen-dependent nature of sterol biosynthesis. Additionally, drugs that target other enzymes in the ergosterol biosynthetic pathway, such as terbinafine and fenpropimorph, can also induce ERG11 promoter activity, further supporting the hypothesis that ERG11 expression is regulated in response to total sterol levels rather than specific intermediates .

What phenotypes are observed in erg11 mutants of S. cerevisiae?

The erg11 mutants of S. cerevisiae display several characteristic phenotypes that reflect the essential nature of this enzyme in fungal physiology. The most prominent phenotype is temperature sensitivity, with mutants showing a lethal phenotype at 37°C . This temperature-dependent lethality is a direct consequence of deficient ergosterol production, which compromises membrane integrity at elevated temperatures.

At permissive temperatures, erg11 mutants typically exhibit reduced growth rates compared to wild-type strains, reflecting the importance of proper ergosterol synthesis for normal cellular proliferation. These mutants also show reduced ergosterol content in their membranes, which can be partially remediated by heterologous expression of ERG11 orthologs from other species, though often with incomplete restoration of wild-type phenotypes .

The cell morphology of erg11 mutants may also be altered, with changes in cell wall structure and membrane organization. Microscopic examination often reveals irregular cell shapes and sizes compared to wild-type cells. Additionally, erg11 mutants frequently show increased sensitivity to a range of chemical stressors beyond azole drugs, including osmotic stress agents and membrane-disrupting compounds, highlighting the broader importance of ergosterol in stress resistance mechanisms.

What molecular mechanisms underlie azole resistance in relation to ERG11 mutations?

Azole resistance mediated by ERG11 mutations involves several molecular mechanisms that reduce drug binding affinity while maintaining catalytic function. Specific amino acid substitutions within the ERG11 protein can alter the three-dimensional structure of the enzyme's active site or access channels, thereby reducing azole binding without significantly compromising enzymatic activity. Studies have identified several critical amino acid positions where substitutions contribute significantly to azole resistance. For instance, mutations encoding amino acid substitutions such as A114S, Y132H, Y132F, K143R, K143Q, and Y257H have been shown to contribute to significant increases (≥fourfold) in fluconazole and voriconazole resistance .

The molecular mechanism of resistance varies depending on the specific mutation location. Substitutions at position Y132, located within the active site of the enzyme, directly affect azole binding by altering heme-azole interactions. In contrast, mutations at positions like K143 may affect the substrate access channel rather than directly interfering with azole binding. The cumulative effect of multiple mutations can lead to high-level resistance, explaining why clinical isolates with multiple ERG11 mutations often display more pronounced resistance phenotypes.

Experimental approaches to study these mechanisms include site-directed mutagenesis to recreate clinical mutations in laboratory strains, heterologous expression in S. cerevisiae to isolate the effects of specific mutations, and structural biology techniques to visualize protein-drug interactions . Comprehensive analysis requires both phenotypic characterization (minimum inhibitory concentration determinations) and biochemical assays with purified recombinant protein to measure direct changes in azole binding affinity. The relative contribution of different mutations varies with specific azole drugs, with some mutations showing differential effects against fluconazole versus itraconazole or voriconazole.

How do specific promoter elements affect ERG11 expression under different stress conditions?

The ERG11 promoter contains specific regulatory elements that respond to various stress conditions, particularly sterol depletion. In C. albicans (which provides a well-studied model), the ERG11 promoter contains a crucial Azole Responsive Element (ARE) that includes two key components: an imperfect inverted repeat (INV) and a Sterol Regulatory Element (SRE) . These elements work together to mediate the transcriptional response to azole drugs and sterol depletion.

The SRE in the C. albicans ERG11 promoter shows homology to the core SRE defined in Saccharomyces, while the INV element is distinct and appears to be an imperfect inverted repeat. Experimental evidence suggests that both elements are essential for azole induction of ERG11 expression, with deletion or mutation of either element significantly reducing the azole response . This dual-element structure suggests that transcription factors like Upc2p might function as dimers, binding to both elements simultaneously, though definitive evidence for dimerization is still being investigated.

Similar AREs with two elements separated by a spacer exist in the promoters of other ergosterol biosynthesis genes, such as ERG2. In ERG2, two SRE-like elements in inverted orientation are separated by 14 base pairs, suggesting a conserved regulatory mechanism across multiple genes in the pathway . This architectural similarity indicates a coordinated regulatory network controlling the entire ergosterol biosynthesis pathway rather than isolated regulation of individual genes.

The functional importance of these elements can be demonstrated through reporter gene assays using constructs where the ERG11 promoter drives expression of luciferase. Such assays have shown that maximal induction by azoles occurs not during logarithmic growth but after the diauxic shift, and requires continuous azole exposure throughout logarithmic growth . The timing of this response correlates with measurements of nascent sterol synthesis and total sterol content, supporting the hypothesis that ERG11 regulation responds primarily to cellular sterol levels rather than directly to the presence of inhibitors.

What experimental approaches can be used to study ERG11 protein-drug interactions?

Multiple experimental approaches provide complementary insights into ERG11-drug interactions, ranging from whole-cell assays to atomic-level structural studies. At the cellular level, researchers can employ growth inhibition assays with recombinant S. cerevisiae strains expressing mutant ERG11 variants to assess how specific mutations affect drug susceptibility. These bioassays provide a physiologically relevant context but cannot distinguish direct drug binding effects from other cellular processes affecting drug action.

For more direct analysis of protein-drug interactions, recombinant ERG11 protein can be expressed and purified for in vitro biochemical studies. Common expression systems include E. coli, yeast, and insect cells, each with specific advantages for maintaining proper folding and heme incorporation. The purified protein can then be used in spectral binding assays, where changes in the heme spectrum upon azole binding allow quantification of binding affinity. These assays can precisely measure how specific mutations alter drug binding constants (Kd values) independently of other cellular factors.

Advanced biophysical techniques provide deeper insights into the structural basis of ERG11-drug interactions. X-ray crystallography of ERG11 in complex with various azoles reveals the precise binding mode and critical interaction points within the active site. These structures help explain how specific mutations confer resistance by altering key contacts. Molecular dynamics simulations can extend these static crystal structures to model the dynamic aspects of drug binding, including changes in protein flexibility or access channel dimensions that may not be apparent in crystal structures.

Thermal shift assays (differential scanning fluorimetry) offer a medium-throughput approach to assess drug binding by measuring changes in protein thermal stability upon ligand binding. Additionally, hydrogen-deuterium exchange mass spectrometry can map regions of the protein that become protected or exposed upon drug binding, providing insights into conformational changes that accompany inhibition. These complementary approaches build a comprehensive understanding of how azoles interact with ERG11 and how resistance mutations disrupt these interactions while preserving catalytic function.

How can heterologous expression systems be optimized for functional studies of recombinant ERG11 variants?

Optimization of heterologous expression systems for ERG11 functional studies requires careful consideration of multiple factors to ensure proper protein folding, cofactor incorporation, and membrane association. For S. cerevisiae ERG11, which is normally associated with the endoplasmic reticulum through an N-terminal signal peptide, maintaining proper subcellular localization can be critical for function. When expressing ERG11 in yeast systems, using endogenous promoters or inducible promoters like GAL1 provides controlled expression, while epitope tags or fluorescent protein fusions allow tracking of protein localization and expression levels .

The choice of expression host significantly impacts functional studies. S. cerevisiae offers a homologous environment for studying S. cerevisiae ERG11, while also serving as a heterologous system for ERG11 from other fungal species. Complementation experiments in erg11 temperature-sensitive mutants provide a powerful functional readout, as successful complementation can be assessed by restored growth at non-permissive temperatures. For instance, studies have shown that while AoErg11 genes from A. oryzae can partially compensate for ergosterol content in S. cerevisiae erg11 mutants, they cannot fully restore the temperature-sensitive lethal phenotype, highlighting the importance of species-specific factors .

For biochemical studies requiring purified protein, expression in E. coli often requires significant optimization. ERG11 contains a heme cofactor essential for function, so co-expression with heme biosynthesis genes or supplementation with δ-aminolevulinic acid may be necessary. Additionally, removing the N-terminal membrane-spanning domain can improve solubility while maintaining catalytic activity. For structural studies, insect cell expression systems often provide better protein quality, though with lower yields than bacterial systems.

Post-translational modifications, particularly N-terminal processing and membrane insertion, can significantly impact ERG11 function. Research has shown that the signal peptide of ERG11 is critical for proper localization to the endoplasmic reticulum, and removal of this signal peptide results in cytoplasmic localization with altered functionality . Experimental designs must consider these factors, particularly when comparing wildtype and mutant variants, to ensure that observed functional differences are due to the mutations themselves rather than differences in expression level, folding, or localization.

What techniques are available for measuring ergosterol content in yeast cells expressing recombinant ERG11?

Several analytical techniques provide accurate quantification of ergosterol in yeast cells expressing recombinant ERG11, each with specific advantages. Gas chromatography coupled with mass spectrometry (GC-MS) offers high sensitivity and specificity for ergosterol quantification. This technique requires extraction of sterols from yeast cells using organic solvents (typically methanol-chloroform mixtures), followed by derivatization to improve volatility. GC-MS provides not only total ergosterol content but also profiles of sterol intermediates, offering insights into specific blockages in the pathway caused by ERG11 mutations or drug treatments.

High-performance liquid chromatography (HPLC) with UV detection at 280-282 nm presents an alternative that does not require derivatization and can be coupled with mass spectrometry for additional structural confirmation. For routine measurements of total ergosterol, spectrophotometric methods based on the characteristic UV absorption spectrum of ergosterol (peaks at 281.5, 293.5, and 282 nm) provide a simpler approach, though with less specificity than chromatographic methods.

Isotope labeling approaches using 13C-labeled glucose or acetate allow for dynamic measurements of ergosterol synthesis rates rather than just static content. These methods can track the incorporation of labeled precursors into ergosterol over time, providing crucial information about how ERG11 mutations or inhibitors affect the flux through the pathway. Research has shown that nascent sterol synthesis parallels ERG11 promoter activity, with total sterols becoming reduced coincident with the timing of ERG11 promoter activation .

When comparing different yeast strains or conditions, it is essential to normalize ergosterol content to cell number, dry weight, or total phospholipid content to account for differences in cell size or growth phase. Studies have demonstrated that ergosterol content varies significantly across growth phases, with specific patterns observed at 24h (active growth), 48h (relative maturity), and 72h (conidial production) . This temporal variation must be considered when designing experiments to assess the impact of recombinant ERG11 expression on ergosterol biosynthesis.

How can researchers design effective ERG11 mutagenesis studies to investigate azole resistance mechanisms?

Designing effective ERG11 mutagenesis studies requires a strategic approach that combines clinical observations with structural insights. Researchers should begin by surveying clinical isolates with documented azole resistance to identify naturally occurring mutations associated with treatment failure. These clinically relevant mutations provide a foundation for targeted laboratory studies. Next, structural information from ERG11 crystal structures should be analyzed to identify residues in the active site, substrate access channel, or heme-binding region that might influence azole binding without eliminating catalytic function.

Site-directed mutagenesis remains the gold standard for introducing specific mutations. For S. cerevisiae ERG11, this can be accomplished using plasmid-based systems with subsequent transformation into wild-type or erg11 mutant strains. To isolate the effect of ERG11 mutations from other resistance mechanisms, heterologous expression in a defined genetic background is crucial. Studies have successfully used site-directed mutagenesis to recreate clinical mutations in laboratory strains, demonstrating that specific substitutions like A114S, Y132H, Y132F, K143R, Y257H, and K143Q contribute significantly to increased fluconazole and voriconazole resistance .

For a more comprehensive approach, researchers can employ random mutagenesis followed by selection on azole-containing media to identify novel resistance mutations. This unbiased approach may reveal unexpected mechanisms of resistance. Alternatively, systematic alanine scanning mutagenesis of regions predicted to interact with azoles can map the full landscape of residues contributing to drug binding. In all cases, confirming that mutations do not simply eliminate ERG11 function is essential, as non-functional enzymes would not represent clinically relevant resistance mechanisms.

Advanced genetic approaches include CRISPR-Cas9 genome editing to introduce mutations directly into the chromosomal ERG11 locus, avoiding artifacts associated with plasmid-based overexpression. For investigating combinations of mutations, statistical design of experiments can help manage the large number of possible combinations while identifying synergistic interactions between multiple substitutions. Complementing these genetic approaches with structural studies of mutant proteins provides mechanistic insights into how specific amino acid changes alter drug binding without compromising catalytic function.

What are the best practices for analyzing ERG11 promoter activity in response to azole treatment?

Analyzing ERG11 promoter activity in response to azole treatment requires careful experimental design and appropriate reporter systems. Luciferase reporter assays provide a sensitive and quantitative measure of promoter activity. By cloning the ERG11 promoter upstream of luciferase genes (such as the Renilla luciferase), researchers can monitor real-time changes in promoter activity across different conditions . This approach has revealed that maximal induction of the ERG11 promoter by azoles occurs not during logarithmic growth but after the diauxic shift, and requires continuous azole exposure throughout logarithmic growth .

When designing these experiments, several factors require careful consideration. First, the length of the promoter fragment is critical—too short, and essential regulatory elements may be excluded; too long, and unrelated upstream elements may confound results. Studies of the C. albicans ERG11 promoter have identified specific regulatory elements, including Sterol Regulatory Elements (SREs) and an imperfect inverted repeat, that are essential for azole response . Deletion analysis of promoter fragments can map these regulatory regions precisely.

The choice of azole concentration and exposure time significantly impacts results. Sub-inhibitory concentrations that do not completely arrest growth are preferred for analyzing transcriptional responses. Time-course experiments are essential, as ERG11 induction by azoles shows distinct temporal patterns, with maximal response typically occurring 24-48 hours after treatment . The growth phase of the culture at the time of azole addition also affects the response, with different patterns observed in logarithmic versus post-diauxic growth.

Environmental factors, including carbon source, pH, and oxygen availability, substantially influence ERG11 promoter activity and its response to azoles . Therefore, standardizing these conditions across experiments is essential for reproducible results. For comprehensive analysis, combining reporter assays with direct measurements of mRNA levels (via Northern blot or qRT-PCR) and nascent sterol synthesis provides a more complete picture of how ERG11 regulation responds to azole treatment under various conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.