Recombinant Saccharomyces cerevisiae LETM1 domain-containing protein YLH47, mitochondrial (YLH47)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted according to your requirements.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
YLH47; MRS7; YPR125W; LETM1 domain-containing protein YLH47, mitochondrial; LETM1 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
46-454
Protein Length
Full Length of Mature Protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YLH47
Target Protein Sequence
NSSVPESSKKELKTTDGNQESASKVSPVKEKEKVPFKVKMQKALRHYWDGSKLLGLEIKI SSKLLMKSAAGYPLTRRENLQLKRTTQDIVRLVPFAAFLIIPFAELLLPFALKLFPNLLP STYESSKKRENKLENLRNTRKLMSEIIKNNKSHFKPNNISEEQKALFNRFYTHVRATGVP ESRQQLIEVARLFTDDTVLDNVTRPYLIALAKYMNLQPFGTDVMLRYRIRYKMLELKKDD LSIYYEDAEQLSLSELKTACASRGIRSVDVEPSVLYSNLRLWLNMRLKDKIPSTLLIMAT AYNYGNVQSKESLYDALCDVLIGIPDELYHEVKVNVVKEDEASAKQKLKQLREQEEIMKE EEQQEENAIVSVKDELSLDDQDKNIDAAAPDVKPHDTKPIGEAAAIKEK
Uniprot No.

Target Background

Function
This protein is involved in regulating mitochondrial potassium homeostasis via mitochondrial K+/H+ exchange.
Gene References Into Functions
  1. Analysis of YLH47 function. PMID: 16476776
Database Links

KEGG: sce:YPR125W

STRING: 4932.YPR125W

Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is YLH47 and how does it relate to human Letm1?

YLH47 (Ypr125w) is a mitochondrial protein in Saccharomyces cerevisiae that displays significant sequence similarity to human Letm1. YLH47, along with another yeast protein Mdm38 (Yol027c), are considered orthologues of Letm1, which is implicated in Wolf-Hirschhorn syndrome (WHS) in humans. The name YLH47 actually stands for "yeast LETM1 homologue of 47 kD," highlighting its evolutionary relationship to the human protein .

While they share homology, there are notable differences in function. YLH47 and Mdm38 function primarily as monovalent cation/H+ antiporters (exchanging K+, Na+, and Li+ for H+), whereas human Letm1 also possesses Ca2+/H+ antiport activity that is absent in the yeast homologs .

Where is YLH47 localized within mitochondria and how is it transported there?

YLH47 is specifically localized to the inner mitochondrial membrane of yeast cells. The protein contains a transmembrane domain that anchors it within this membrane .

The transport mechanism of YLH47 into mitochondria involves crossing the inner mitochondrial membrane, similar to the transport process of Mdm38 and Letm1. This translocation occurs post-translationally and requires the mitochondrial protein import machinery. While the exact import pathway has not been fully characterized for YLH47 specifically, it likely utilizes the TIM23 complex for translocation across the inner membrane, as is common for many inner membrane proteins with N-terminal targeting sequences .

What ion transport activities has YLH47 been demonstrated to possess?

YLH47 has been experimentally demonstrated to function as a monovalent cation/H+ antiporter. Specifically, it exhibits:

  • K+/H+ antiport activity

  • Na+/H+ antiport activity

  • Li+/H+ antiport activity

Importantly, unlike its human homolog Letm1, YLH47 lacks Ca2+/H+ antiport activity . This functional distinction between YLH47 and Letm1 represents a significant evolutionary divergence that may be related to the absence of EF-hand domains in YLH47, which are present in Letm1 and are components of calcium signaling .

The Na+/H+ antiport activity of YLH47 has been demonstrated in complementation studies using Na+/H+ antiporter-deficient Escherichia coli strain TO114, indicating that YLH47 can facilitate Na+ efflux .

How can recombinant YLH47 protein be expressed and purified for functional studies?

For recombinant expression and purification of YLH47, researchers typically follow these methodological steps:

  • Vector Construction: Clone the YLH47 gene (YPR125W) into an appropriate expression vector containing a promoter compatible with your expression system (bacterial, yeast, or insect cells). Including a purification tag such as 6xHis, FLAG, or GST is recommended.

  • Expression System Selection: While E. coli can be used for expression, using Saccharomyces cerevisiae as the expression host may provide more authentic post-translational modifications and proper folding for this mitochondrial protein.

  • Expression Optimization: When using yeast expression systems, optimal growth conditions typically involve growth at 30°C in selective media appropriate for the auxotrophic marker of the expression plasmid.

  • Mitochondrial Isolation: For functional studies, isolation of intact mitochondria containing the overexpressed YLH47 can be performed using differential centrifugation techniques.

  • Membrane Protein Solubilization: As an inner mitochondrial membrane protein, YLH47 requires detergent solubilization. Mild detergents such as n-dodecyl β-D-maltoside (DDM) or digitonin are typically used to maintain protein structure and function.

  • Purification Strategy: For tagged YLH47 variants, affinity chromatography followed by size exclusion chromatography can yield purified protein suitable for biochemical and structural studies .

When conducting functional assays with the purified protein, reconstitution into liposomes or nanodiscs may be necessary to assess ion transport activities in a membrane environment.

What experimental methods are most effective for studying YLH47 ion transport activity?

Several complementary experimental approaches have proven effective for characterizing the ion transport activity of YLH47:

  • Complementation in Bacterial Systems: Using Na+/H+ antiporter-deficient E. coli strains such as TO114 to demonstrate functional complementation by YLH47. This approach allows assessment of Na+ efflux activity through growth tests on high-salt media .

  • Inverted Membrane Vesicle Assays: Preparation of inverted membrane vesicles from E. coli expressing YLH47 allows direct measurement of ion transport activities. Transport is typically monitored using fluorescent probes such as acridine orange to detect pH gradients, or by direct measurement of ion fluxes using ion-selective electrodes or radioactive ion tracers .

  • Submitochondrial Particle (SMP) Assays: SMPs prepared from yeast mitochondria can be used to measure K+/H+ exchange activity across the inner mitochondrial membrane. This technique provides a more native environment for assessing YLH47 function .

  • Liposome Reconstitution: Purified YLH47 protein can be reconstituted into liposomes loaded with specific ions or fluorescent indicators to directly measure ion transport kinetics and specificity.

  • Site-Directed Mutagenesis: Combining the above techniques with site-directed mutagenesis of conserved residues (particularly the glutamic acid in the pore-forming region) allows identification of key functional domains required for ion transport .

The combination of these techniques has revealed that YLH47 mediates electroneutral exchange of monovalent cations (K+, Na+, Li+) for H+, with stoichiometries similar to those observed with the ionophore nigericin .

How can researchers best design experiments to distinguish between the functions of YLH47 and Mdm38?

To effectively distinguish between the functions of YLH47 and Mdm38, researchers should implement the following experimental design strategies:

  • Single and Double Deletion Studies: Generate and compare single deletion mutants (ylh47Δ and mdm38Δ) and double deletion mutants (ylh47Δ/mdm38Δ) to identify unique and overlapping phenotypes. Previous research has shown that ylh47Δ/mdm38Δ mitochondria exhibit additional protein level reductions compared to single mdm38Δ mutants, suggesting some functional redundancy .

  • Complementation Experiments: Perform cross-complementation tests where YLH47 is expressed in mdm38Δ cells and vice versa to determine the extent of functional overlap.

  • Domain Swap Experiments: Create chimeric proteins containing domains from both YLH47 and Mdm38 to identify which regions are responsible for their unique functions.

  • Quantitative Proteomics: Compare the mitochondrial proteome in wild-type, ylh47Δ, mdm38Δ, and ylh47Δ/mdm38Δ strains to identify differential effects on protein abundance. Data analysis should focus on respiratory chain components and mitochondrial translation machinery.

  • Ion Transport Specificity Assays: Design assays that specifically measure the different ionic preferences of each transporter under identical conditions, focusing on potential kinetic differences.

  • Subcellular Co-localization: Use immunofluorescence or proximity labeling techniques to determine whether YLH47 and Mdm38 occupy distinct sub-mitochondrial locations or associate with different protein complexes.

This experimental framework allows for methodical differentiation between the unique and overlapping functions of YLH47 and Mdm38 in maintaining mitochondrial ion homeostasis and supporting respiratory chain assembly .

What is the structural basis for YLH47's inability to transport Ca2+ compared to its homolog Letm1?

The inability of YLH47 to transport Ca2+ (unlike human Letm1) appears to be related to key structural differences between these homologous proteins. Based on structural modeling and functional studies, several factors contribute to this distinction:

  • Absence of EF-hand Domains: A critical structural difference is that YLH47 lacks the EF-hand Ca2+ binding domains that are present in human Letm1. These EF-hand domains are known components of calcium signaling pathways and are likely essential for the Ca2+/H+ antiport activity of Letm1 .

  • Conserved Pore-Forming Region: Despite the inability to transport Ca2+, YLH47 maintains a highly conserved glutamic acid residue in the pore-forming membrane-spanning region. This glutamic acid is crucial for ion transport activity, as demonstrated by mutagenesis studies where replacement with alanine significantly impaired the ability of YLH47 to complement the salt sensitivity of E. coli TO114 .

  • Evolutionary Specialization: The functional divergence suggests that while Letm1 evolved to participate in both Ca2+ homeostasis and monovalent cation transport, YLH47 specialized primarily for monovalent cation/H+ exchange to maintain membrane potential across the inner mitochondrial membrane in yeast.

Researchers investigating this structural basis should consider employing:

  • Detailed structural modeling of the ion-binding site

  • Construction of chimeric transporters combining domains from YLH47 and Letm1

  • Targeted mutagenesis of residues in the pore region to potentially confer Ca2+ transport activity to YLH47

These approaches would provide valuable insights into the molecular determinants of ion selectivity in this transporter family .

How does YLH47 coordinate with Mdm38 in maintaining mitochondrial cation homeostasis?

The coordination between YLH47 and Mdm38 in maintaining mitochondrial cation homeostasis is complex and involves both unique and overlapping functions:

  • Functional Redundancy with Specialization: While both proteins mediate K+/H+, Na+/H+, and Li+/H+ exchange, they appear to have specialized roles. The phenotype of ylh47Δ/mdm38Δ double mutants shows additional defects compared to single mdm38Δ mutants, particularly in the levels of specific respiratory chain components such as Atp3 and cytochrome c1 (Cyt1) .

  • Differential Impact on Respiratory Chain Components: mdm38Δ mitochondria show reduced amounts of certain mitochondrially encoded proteins and low levels of complex III and IV, along with accumulated unassembled Atp6 of complex V. This suggests Mdm38 plays a more prominent role in respiratory chain assembly than YLH47, which shows minimal effects when deleted alone .

  • Compensatory Mechanisms: The mild phenotype of ylh47Δ single mutants suggests that Mdm38 can largely compensate for YLH47 loss, while the reverse is not entirely true. This indicates an asymmetric relationship where Mdm38 may be the primary actor and YLH47 serves a supporting or specialized role .

  • Potential Physical Interaction: Though not explicitly demonstrated in the provided research, these proteins may function in proximity or even as part of larger protein complexes within the inner mitochondrial membrane to coordinate their activities.

The system likely represents an evolved redundancy to ensure robust maintenance of mitochondrial ion homeostasis, with Mdm38 playing the more critical role and YLH47 providing specialized support functions or serving as a backup system .

What is the relationship between YLH47's ion transport activity and mitochondrial protein translation?

The relationship between YLH47's ion transport activity and mitochondrial protein translation represents a fascinating connection between ion homeostasis and protein synthesis machinery:

  • Indirect Effects via Membrane Potential: YLH47's monovalent cation/H+ antiport activity contributes to maintaining the proper membrane potential across the inner mitochondrial membrane. This electrochemical gradient is essential for efficient mitochondrial protein import and translation. Disruption of this gradient in ylh47Δ/mdm38Δ double mutants likely contributes to the observed decreases in mitochondrially encoded proteins .

  • Ribosome Interaction Domain: Notably, Mdm38 contains a ribosome-binding domain that is important for its function in mitochondrial protein translation. Deletion of this domain in Mdm38 results in decreased Na+ efflux activity, suggesting a structural or functional link between ribosome binding and ion transport activities . YLH47 may have similar but unexplored interactions with the translation machinery.

  • Specific Effect on Mitochondrially Encoded Proteins: The ylh47Δ/mdm38Δ double mutant shows reduced levels of mitochondrially encoded respiratory chain components, including Atp3 and cytochrome c1 (Cyt1). This suggests that these transporters, potentially through their effects on matrix pH and ion concentrations, create optimal conditions for the synthesis of specific mitochondrial proteins .

  • Possible Direct Interaction with Translation Components: Beyond their ion transport functions, both YLH47 and Mdm38 may physically interact with components of the mitochondrial translation machinery, serving as scaffold proteins that help organize translation complexes near sites of respiratory chain assembly.

This coupling between ion transport and translation highlights the integrated nature of mitochondrial functions and suggests that YLH47 plays a role in coordinating these essential processes to maintain mitochondrial health .

How should researchers interpret differences in phenotypes between ylh47Δ and mdm38Δ mutants?

When interpreting phenotypic differences between ylh47Δ and mdm38Δ mutants, researchers should consider the following methodological framework:

  • Primary vs. Secondary Effects: Distinguish between direct effects of the deletions and secondary consequences. For example, the reduced levels of certain mitochondrial proteins in mdm38Δ mutants may be a direct consequence of impaired protein translation or an indirect effect of altered membrane potential affecting protein import or stability .

  • Severity Assessment: The severity gradient observed (wild-type ≈ ylh47Δ < mdm38Δ < ylh47Δ/mdm38Δ) suggests a hierarchical relationship where Mdm38 plays a more critical role, while YLH47 provides supplementary or redundant functions that become significant only in the absence of Mdm38 .

  • Protein-Specific Effects: Analysis should acknowledge the differential effects on specific proteins. For instance, mdm38Δ mitochondria show reduced amounts of mitochondrially encoded Atp9 and cytochrome b (Cob), the nuclear-encoded Rieske Fe/S-protein (Rip1) of complex III, and slight reduction in Cox3 levels. Meanwhile, ylh47Δ mitochondria show protein levels similar to wild-type .

  • Growth Phenotype Correlation: Note that despite similar growth defects between mdm38Δ and ylh47Δ/mdm38Δ cells, the double mutant shows additional protein deficiencies, suggesting that growth phenotypes alone may not reveal the full spectrum of molecular defects .

The data suggests a model where YLH47 and Mdm38 have partially overlapping functions in maintaining mitochondrial ion homeostasis, but with Mdm38 playing the predominant role in supporting mitochondrial translation and respiratory chain assembly .

What can transport activity data from bacterial expression systems tell us about YLH47's native function in yeast mitochondria?

Transport activity data from bacterial expression systems provides valuable insights into YLH47's native function, but requires careful interpretation:

  • Conservation of Core Function: The ability of YLH47 to complement Na+/H+ antiporter-deficient E. coli strain TO114 demonstrates that its core ion transport mechanism is conserved and functional even in a bacterial membrane environment. This suggests the fundamental transport activity is an intrinsic property of the protein rather than dependent on yeast-specific cofactors .

  • Ion Specificity Profile: Measurements in E. coli-inverted membranes revealed that YLH47 has K+/H+, Na+/H+, and Li+/H+ antiport activity but lacks Ca2+/H+ antiport activity. This distinct ion specificity profile likely reflects its native function in yeast mitochondria .

  • Structural-Functional Relationships: Mutations of the conserved glutamic acid in the pore-forming region impaired YLH47's ability to complement salt sensitivity in bacteria, indicating this residue is essential for ion transport. This structure-function relationship likely applies to its native environment as well .

  • Limitations of Heterologous Systems: Researchers should recognize that bacterial expression may not recapitulate all aspects of YLH47 function. The protein may lack yeast-specific post-translational modifications, interaction partners, or regulatory mechanisms in bacterial systems.

  • Functional Context: While bacterial systems demonstrate the transport capabilities of YLH47, they don't reveal its integration into the broader mitochondrial physiology, including potential roles in respiratory chain assembly or mitochondrial translation.

A comprehensive model of YLH47 function should integrate data from both heterologous expression systems and native mitochondrial studies to provide a complete picture of its physiological role .

How do the structural and functional properties of YLH47 compare with other cation/H+ antiporters in different organisms?

YLH47 shares structural and functional similarities with various cation/H+ antiporters across different organisms, while also possessing unique characteristics:

The study of YLH47 therefore provides valuable insights into the evolution of cation/H+ antiporters and how these transport mechanisms have been conserved and adapted across different organisms and cellular compartments .

What are the key challenges in expressing and purifying functional recombinant YLH47?

Expressing and purifying functional recombinant YLH47 presents several methodological challenges that researchers must address:

  • Membrane Protein Solubility: As an integral membrane protein, YLH47 contains hydrophobic transmembrane domains that can cause aggregation during expression and purification. Optimizing detergent types and concentrations is critical for maintaining protein solubility without compromising structural integrity.

  • Proper Folding in Heterologous Systems: When expressed in bacterial systems like E. coli, YLH47 may not fold properly due to differences in membrane composition and the absence of mitochondria-specific chaperones. This can result in reduced activity or complete loss of function.

  • Yield Limitations: Expression of mitochondrial membrane proteins often yields lower amounts compared to soluble proteins, necessitating optimization of expression conditions and scale-up strategies.

  • Maintaining Functional Activity: During purification, YLH47 may lose its native conformation and transport activity. Functional assays should be performed at various stages of purification to ensure the protein remains active.

  • Reconstitution Challenges: For functional studies, purified YLH47 must be reconstituted into artificial membrane systems such as liposomes or nanodiscs. Achieving the correct protein orientation and maintaining activity during reconstitution requires careful optimization of lipid composition and reconstitution protocols.

  • Post-translational Modifications: If YLH47 requires specific post-translational modifications for activity, expression in E. coli may not provide these modifications, necessitating the use of eukaryotic expression systems such as yeast or insect cells.

Researchers have addressed these challenges by implementing careful optimization of expression conditions, using mild detergents for solubilization, and verifying protein activity through complementation assays in Na+/H+ antiporter-deficient bacterial strains .

How can researchers accurately measure ion transport activity of YLH47 in isolated mitochondria?

Accurately measuring YLH47's ion transport activity in isolated mitochondria requires specialized techniques to overcome several technical challenges:

  • Mitochondrial Isolation Protocol:

    • Start with spheroplast preparation using zymolyase treatment of yeast cells

    • Use differential centrifugation to obtain pure, intact mitochondria

    • Verify mitochondrial integrity through respiratory control ratio measurements

    • Compare preparations from wild-type, ylh47Δ, mdm38Δ, and ylh47Δ/mdm38Δ strains

  • Submitochondrial Particle (SMP) Preparation:

    • Generate inside-out vesicles from mitochondria through sonication or French press treatment

    • Purify SMPs through density gradient centrifugation

    • Verify orientation using marker enzyme accessibility tests

  • Ion Transport Measurement Techniques:

    • Fluorescence-based assays: Use pH-sensitive fluorescent dyes like ACMA (9-amino-6-chloro-2-methoxyacridine) to monitor H+ movement

    • Ion-selective electrodes: Directly measure changes in ion concentrations in the medium

    • Isotope flux assays: Use radioisotopes (42K+, 22Na+) to track ion movement across membranes

    • Membrane potential monitoring: Use voltage-sensitive dyes like DiSC3(5) to correlate ion transport with changes in membrane potential

  • Experimental Controls and Validations:

    • Use specific inhibitors to distinguish YLH47 activity from other transporters

    • Include ionophores like nigericin as positive controls for K+/H+ exchange

    • Compare transport rates in the presence of various cations to establish specificity

    • Validate results using complementation with recombinant YLH47 in deletion strains

  • Data Analysis Approaches:

    • Calculate initial rates of transport under various conditions

    • Determine ion selectivity by comparing transport rates with different ions

    • Establish kinetic parameters (Km, Vmax) for different substrates

    • Correlate transport activity with physiological effects on mitochondrial function

This systematic approach allows for reliable measurement of YLH47's ion transport activity in its native mitochondrial environment while distinguishing its contribution from other transporters .

What experimental controls are essential when studying the effects of YLH47 deletion on mitochondrial function?

When studying the effects of YLH47 deletion on mitochondrial function, implementing appropriate experimental controls is crucial for rigorous scientific interpretation. The following controls should be considered essential:

  • Isogenic Wild-Type Controls:

    • Use wild-type strains with identical genetic background except for the YLH47 gene

    • Maintain consistent growth conditions between wild-type and ylh47Δ strains

    • Process all samples identically during mitochondrial isolation and analysis

  • Single and Double Deletion Comparisons:

    • Include mdm38Δ single mutants and ylh47Δ/mdm38Δ double mutants to distinguish unique and overlapping functions

    • This comparative approach helps identify potential compensatory mechanisms and functional redundancy

  • Complementation Controls:

    • Reintroduce wild-type YLH47 gene to confirm that observed phenotypes are specifically due to YLH47 deletion

    • Include non-functional YLH47 mutants (e.g., pore region glutamic acid mutants) as negative controls

  • Domain-Specific Controls:

    • Use YLH47 constructs lacking specific domains to attribute functions to particular protein regions

    • This approach has been successfully used with Mdm38, where deletion of the ribosome-binding domain affected Na+ efflux activity

  • Physiological Parameter Controls:

    • Monitor multiple aspects of mitochondrial function beyond the specific parameter being studied:

      • Membrane potential (using fluorescent dyes like TMRM or JC-1)

      • Respiratory capacity (oxygen consumption measurements)

      • ATP production

      • Reactive oxygen species generation

    • This comprehensive approach helps distinguish primary from secondary effects

  • Technical Validation Controls:

    • Include appropriate positive and negative controls for each assay

    • Perform time-course experiments to distinguish acute from adaptive responses

    • Use pharmacological agents that mimic the expected effect of YLH47 deletion

The implementation of these controls enables researchers to confidently attribute observed phenotypes to YLH47 deletion while minimizing misinterpretation due to secondary effects or technical artifacts .

What is the comparative ion transport activity of YLH47 versus Mdm38 and human Letm1?

Based on the available research data, here is a comparative analysis of the ion transport activities of YLH47, Mdm38, and human Letm1:

Transport ActivityYLH47Mdm38Human Letm1
K+/H+ exchangeYesYesYes
Na+/H+ exchangeYesYesYes
Li+/H+ exchangeYesYesYes
Ca2+/H+ exchangeNoNoYes
Transport ElectrogenicityElectroneutralElectroneutralDebated*
EF-hand Ca2+ binding domainsAbsentAbsentPresent
Complementation of mdm38Δ growth defectPartialCompleteYes

*The electrogenicity of Letm1-mediated Ca2+/H+ exchange has been debated in the literature.

The key differences emerge in calcium transport capability, which appears to be a unique feature of the human Letm1 protein, likely related to the presence of EF-hand Ca2+ binding domains that are absent in both yeast homologs. All three proteins share the ability to transport monovalent cations (K+, Na+, Li+) in exchange for protons, suggesting this is an evolutionarily conserved core function .

The data indicates that while YLH47 and Mdm38 are functionally similar in terms of ion selectivity, they may differ in their physiological roles, as evidenced by the more severe phenotypes observed in mdm38Δ mutants compared to ylh47Δ .

What are the key structural and functional differences between YLH47 and Mdm38 based on current research?

Current research reveals several important structural and functional differences between YLH47 and Mdm38:

FeatureYLH47Mdm38Significance
Molecular Weight47 kD58 kDIndicates structural differences
Phenotype of Single DeletionMinimal growth defect; normal mitochondrial protein levelsSignificant growth defect; reduced levels of mitochondrial proteinsSuggests Mdm38 plays a more critical role
Ribosome BindingNot characterizedContains a ribosome-binding domain important for functionIndicates Mdm38's direct role in mitochondrial translation
Effect on Respiratory ChainMinimal when deleted aloneReduced amounts of complex III and IV; accumulation of unassembled Atp6Suggests Mdm38's important role in respiratory chain assembly
Protein Translation EffectsMinimal when deleted aloneRequired for efficient transport of Atp6 and cytochrome bHighlights Mdm38's role in mitochondrial protein synthesis
Role in Double DeletionDeletion alongside mdm38Δ causes additional reductions in Atp3 and cytochrome c1 levelsPrimary contributor to phenotypeSuggests partially overlapping functions

These differences indicate that while both proteins share ion transport capabilities, Mdm38 has additional functions in mitochondrial protein translation and respiratory chain assembly that YLH47 lacks or performs to a lesser extent. The double deletion phenotype suggests that YLH47 may play a complementary or backup role that becomes more important in the absence of Mdm38 .

The structural basis for these functional differences might include distinct protein interaction domains or regulatory elements that remain to be fully characterized. Despite their homology, these proteins appear to have undergone functional specialization in yeast mitochondria .

How does the targeted mutation of conserved residues affect YLH47 transport activity?

Research on the effects of targeted mutations in YLH47 has identified key residues crucial for its transport function:

MutationLocationEffect on Transport ActivityComplementation of E. coli TO114Mechanism
E → A (Glutamic acid to Alanine)Conserved glutamic acid in pore-forming membrane-spanning regionSignificantly impairedFailed to complement salt sensitivityDisruption of ion coordination site
Deletion of ribosome-binding domain*N-terminal regionDecreased Na+ efflux activityReduced complementationPotential structural effects on transport mechanism
Mutations in transmembrane domainMembrane-spanning regionVariable depending on specific residueRange from partial to complete loss of functionAltered pore structure or ion selectivity

*This data refers to Mdm38 but provides insight into potential effects for similar mutations in YLH47

The most significant finding is that replacement of the highly conserved glutamic acid residue in the pore-forming membrane-spanning region with alanine (a non-polar amino acid) severely impairs YLH47's transport function. This glutamic acid appears to be essential for ion coordination and transport, as its mutation significantly reduced the ability of YLH47 to complement the salt sensitivity of E. coli TO114 .

These mutagenesis studies highlight the critical structural elements required for YLH47's ion transport activity and provide valuable insights into the molecular mechanism of cation/H+ antiport in this protein family. The conservation of this glutamic acid residue across the Letm1-Mdm38-YLH47 family suggests a shared fundamental transport mechanism despite differences in ion selectivity .

What are the most promising approaches for determining the high-resolution structure of YLH47?

Determining the high-resolution structure of YLH47 presents unique challenges as a membrane protein, but several promising approaches could yield success:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Currently the most promising technique for membrane protein structure determination

    • Advantages include no need for crystallization and ability to capture multiple conformational states

    • Challenges include sample preparation optimization and potential need for larger protein complexes to achieve high resolution

    • Strategy: Express YLH47 with a larger fusion partner or in complex with Fab fragments to increase molecular weight

  • X-ray Crystallography with Modern Enhancements:

    • Lipidic cubic phase (LCP) crystallization has revolutionized membrane protein crystallography

    • Serial crystallography at X-ray free-electron lasers (XFELs) allows data collection from microcrystals

    • Strategy: Screen multiple detergents, lipids, and stabilizing agents to identify optimal crystallization conditions

  • NMR Spectroscopy Approaches:

    • Solid-state NMR avoids the need for complete solubilization

    • Selective isotope labeling can provide specific structural information even without complete structure

    • Strategy: Focus on key regions like the ion-binding site with selective labeling techniques

  • Integrative Structural Biology:

    • Combine lower-resolution experimental data with computational approaches

    • Cross-link mass spectrometry can provide distance constraints

    • Hydrogen-deuterium exchange mass spectrometry can map solvent-accessible regions

    • Strategy: Develop a structural model using multiple complementary techniques

  • Protein Engineering for Structural Studies:

    • Generate thermostabilized variants through systematic mutagenesis

    • Create fusion constructs with crystallization chaperones like T4 lysozyme

    • Remove flexible regions that might hinder crystallization

    • Strategy: Create a library of engineered constructs optimized for structural studies

The most effective approach will likely involve a combination of these methods, with cryo-EM currently offering the highest probability of success for determining YLH47's structure in different conformational states relevant to its transport cycle .

How might the study of YLH47 contribute to understanding human diseases associated with Letm1 dysfunction?

The study of YLH47 offers valuable insights into human diseases associated with Letm1 dysfunction, particularly Wolf-Hirschhorn syndrome (WHS), through several research pathways:

  • Conserved Functional Mechanisms: Despite differences in ion selectivity, the core monovalent cation/H+ exchange function is conserved between YLH47 and human Letm1. Understanding the molecular mechanism of this transport in the yeast system can illuminate how Letm1 dysfunction impacts mitochondrial physiology in human cells .

  • Structural Insights: Identifying critical residues and domains in YLH47 that are conserved in human Letm1 can help predict how specific mutations in Letm1 might contribute to disease phenotypes. The conservation of the essential glutamic acid in the pore-forming region across species highlights potential mutation hotspots that could be examined in WHS patients .

  • Mitochondrial Translation Connection: The relationship between YLH47/Mdm38 and mitochondrial protein synthesis provides a model for understanding how Letm1 deficiency might affect mitochondrial translation in humans. This could explain some of the neurological manifestations of WHS, as neurons are particularly sensitive to mitochondrial dysfunction .

  • Drug Screening Platform: YLH47-expressing yeast can serve as a simplified model system for high-throughput screening of compounds that modulate cation/H+ antiporter activity, potentially identifying therapeutic candidates for Letm1-related disorders.

  • Evolution of Function: The differences between YLH47 and Letm1, particularly regarding Ca2+ transport, provide an evolutionary perspective on how these transporters acquired new functions. This may explain why Letm1 deficiency in humans has more severe consequences than YLH47 deletion in yeast .

  • Functional Redundancy Insights: The partial redundancy between YLH47 and Mdm38 suggests that exploring similar redundancy mechanisms in human cells might identify potential compensatory pathways that could be therapeutically enhanced in WHS patients.

These research directions could ultimately lead to improved understanding of the pathophysiology of WHS and potentially other disorders involving mitochondrial ion homeostasis disruption .

What novel experimental approaches could reveal additional functions of YLH47 beyond ion transport?

To uncover potential functions of YLH47 beyond its established role in ion transport, researchers should consider implementing these innovative experimental approaches:

  • Proximity-Based Proteomics:

    • Employ BioID or APEX2 proximity labeling techniques by fusing these enzymes to YLH47

    • Identify proteins that physically interact with or function near YLH47 in the mitochondrial inner membrane

    • This approach could reveal unexpected associations with translation machinery, respiratory complexes, or signaling pathways

  • Global Genetic Interaction Mapping:

    • Conduct synthetic genetic array (SGA) analysis with ylh47Δ as the query strain

    • Identify genes whose deletion exacerbates or suppresses ylh47Δ phenotypes

    • Analyze enriched functional categories among genetic interactors to reveal biological processes connected to YLH47

  • Metabolomic Profiling:

    • Compare metabolite profiles between wild-type and ylh47Δ mitochondria using mass spectrometry

    • Focus on changes in TCA cycle intermediates, amino acids, and signaling molecules

    • Identify metabolic pathways indirectly affected by YLH47 deletion

  • Conditional Protein Degradation:

    • Implement auxin-inducible or temperature-sensitive degron systems for acute YLH47 depletion

    • Monitor immediate consequences before compensatory mechanisms activate

    • Distinguish between direct and indirect effects of YLH47 loss

  • In situ Structural Analysis:

    • Use techniques like FRET sensors or small-molecule probes to monitor YLH47 conformational changes in response to various stimuli

    • Correlate structural changes with cellular responses to identify potential signaling functions

  • Tissue-Specific Effects in Higher Model Organisms:

    • Express YLH47 in Letm1-depleted mammalian cells or model organisms

    • Determine whether YLH47 can rescue specific aspects of Letm1 deficiency

    • Identify tissue-specific functions that might be conserved despite differences in ion selectivity

  • Response to Stress Conditions:

    • Expose ylh47Δ cells to various stressors (oxidative stress, osmotic stress, nutrient limitation)

    • Identify specific stress conditions where YLH47 becomes particularly important

    • This may reveal conditional functions not apparent under standard growth conditions

These approaches could potentially reveal unexpected roles for YLH47 in processes such as mitochondrial quality control, stress response signaling, or even non-canonical functions completely distinct from its characterized ion transport activity .

What is the current consensus on the physiological role of YLH47 in yeast mitochondria?

The current consensus on YLH47's physiological role in yeast mitochondria can be summarized as follows:

  • Primary Function as Monovalent Cation/H+ Antiporter: YLH47 functions as a K+/H+, Na+/H+, and Li+/H+ antiporter in the inner mitochondrial membrane. Unlike its human homolog Letm1, it lacks Ca2+/H+ antiport activity .

  • Supportive Role in Mitochondrial Ion Homeostasis: YLH47 appears to play a secondary or supportive role in maintaining mitochondrial ion homeostasis, with Mdm38 serving as the primary actor in this process. This is evidenced by the minimal phenotypic effects of YLH47 deletion alone, while significant defects appear in mdm38Δ mutants .

  • Conditional Importance in Mdm38's Absence: YLH47 becomes more physiologically important in the absence of Mdm38, as demonstrated by the additional defects observed in ylh47Δ/mdm38Δ double mutants compared to mdm38Δ single mutants. This suggests a partially redundant function that provides a backup system for mitochondrial ion homeostasis .

  • Indirect Contribution to Respiratory Chain Assembly: Through its role in ion homeostasis, YLH47 indirectly supports the proper assembly and function of respiratory chain complexes. This is particularly evident in the ylh47Δ/mdm38Δ double mutant, which shows additional reductions in respiratory chain components like Atp3 and cytochrome c1 compared to single mutants .

  • Evolutionary Conservation with Functional Specialization: YLH47 represents an evolutionarily conserved transporter with functional specialization distinct from its homologs. The transport mechanism appears conserved from cyanobacterial ancestors, suggesting fundamental importance in mitochondrial physiology .

The consensus view thus portrays YLH47 as a specialized component of the mitochondrial ion transport machinery that works in concert with Mdm38 to maintain the ionic environment necessary for optimal mitochondrial function, with particular importance under conditions where Mdm38 function is compromised .

What are the most significant unanswered questions about YLH47 structure and function?

Despite considerable progress in understanding YLH47, several significant questions remain unanswered:

  • Detailed Molecular Structure: What is the high-resolution structure of YLH47, particularly its ion-binding site and transport pathway? How does this structure compare to Letm1 and explain the differences in ion selectivity?

  • Transport Mechanism: What is the precise stoichiometry and kinetic mechanism of YLH47-mediated ion transport? How is transport regulated in response to changes in membrane potential, pH gradients, or metabolic state?

  • Functional Redundancy with Mdm38: What are the molecular determinants that allow Mdm38 to compensate for YLH47 loss but not vice versa? Are there specific conditions under which YLH47 becomes the predominant transporter?

  • Potential Interaction Partners: Does YLH47 form complexes with other mitochondrial proteins? If so, do these interactions modulate its transport activity or connect it to other mitochondrial processes?

  • Regulatory Mechanisms: How is YLH47 expression and activity regulated in response to cellular or mitochondrial stress? Are there post-translational modifications that affect its function?

  • Evolutionary Significance: Why have yeast evolved two separate LETM1 homologs (YLH47 and Mdm38) with similar transport activities but different physiological roles? What selective pressures drove this functional specialization?

  • Connection to Mitochondrial Translation: Does YLH47 have a direct role in mitochondrial translation similar to Mdm38, or does it affect translation only indirectly through ion homeostasis?

  • Potential Signaling Functions: Beyond ion transport, does YLH47 participate in mitochondrial signaling pathways or stress responses?

  • Relationship to Mitochondrial Dynamics: How does YLH47 function relate to mitochondrial morphology, fission/fusion dynamics, and quality control mechanisms?

  • Therapeutic Potential: Could modulation of YLH47-like activity in human cells provide therapeutic benefits for diseases associated with mitochondrial dysfunction?

Addressing these questions will require integrating structural biology, biophysical approaches, genetic analyses, and systems biology to fully elucidate YLH47's role in mitochondrial physiology .

What methodological advances are needed to advance YLH47 research to the next level?

Advancing YLH47 research to the next level will require several methodological innovations across different aspects of experimental biology:

  • Structural Biology Approaches:

    • Development of improved membrane mimetics (nanodiscs, SMALPs) that better maintain YLH47 structure and function during purification

    • Adaptation of cryo-EM techniques specifically for smaller membrane proteins like YLH47

    • Implementation of integrative structural biology approaches combining multiple lower-resolution techniques

  • Real-Time Ion Transport Measurements:

    • Development of fluorescent sensors that can monitor ion fluxes with greater temporal and spatial resolution in live mitochondria

    • Single-molecule techniques to observe individual transport events

    • Mitochondria-targeted ion-sensitive probes with improved specificity and sensitivity

  • Genetic Engineering Advances:

    • CRISPR-based approaches for precise genomic manipulation of YLH47 in its native context

    • Development of inducible, reversible systems for YLH47 expression/depletion

    • High-throughput mutagenesis combined with functional selection to identify critical residues

  • Systems Biology Integration:

    • Multi-omics approaches that simultaneously track changes in transcriptome, proteome, metabolome, and ionome upon YLH47 manipulation

    • Computational modeling of mitochondrial ion homeostasis incorporating YLH47 transport parameters

    • Network analysis tools to position YLH47 within the broader context of mitochondrial function

  • Translational Research Tools:

    • Development of yeast-based high-throughput screening platforms using YLH47 as a target

    • Creation of equivalent mutations in yeast YLH47 and human Letm1 to directly compare functional effects

    • Generation of mammalian cell lines expressing YLH47 in place of Letm1 to study functional conservation

  • Advanced Microscopy Techniques:

    • Super-resolution microscopy approaches to visualize YLH47 distribution and dynamics within mitochondria

    • Correlative light and electron microscopy to connect YLH47 localization with mitochondrial ultrastructure

    • Live-cell imaging combined with optogenetic tools to manipulate YLH47 activity with spatial and temporal precision

  • Improved Heterologous Expression Systems:

    • Development of specialized expression hosts optimized for mitochondrial membrane proteins

    • Cell-free expression systems incorporating mitochondrial membrane mimetics

    • Directed evolution approaches to generate YLH47 variants with enhanced stability and expression levels

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.