Recombinant Saccharomyces cerevisiae Low-affinity Fe (2+) transport protein

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery information.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during the production process. If you have a designated tag type in mind, please inform us, and we will prioritize the development of the specified tag.
Synonyms
FET4; YMR319C; YM9924.11C; Low-affinity Fe(2+ transport protein; Low-affinity Fe(II transport protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-552
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
FET4
Target Protein Sequence
MGKIAEFLGNPGARPDVHHRAPTVDCKQYEEFGDSNDYKNDDVVRVVSHSDESTDDELCN VNLTETGAIFTSKGFTGLSKGFTDKTLDFLVRVAGSQAVFFIVWIILIIWVVIGIVYNAP FNWQVVMQDGQSIQSYVWDTLLMRQQLMSTHEQILICGRLKSRLASFKNYLTRSTPEEEK ADCTVEANEVSSVENHIDPSAINGELPVENWYDRLSNVASRYMGSIAAMVIFWIGIFVWI GCGAIPKDAGNTPPYTGETTGSNPRLKKFSDAWQMYINTAVAVSLLICTTFLQNIRARHD YFTGRFLVDIFDMDEKIDYRIRKHFNDFETPHPVVTIESKKRSTGRKMIDWYADIIGTGI GVLIGVAVFATWIGIGSPMKWDDNWWLIIGTYTGLIGFLDGFVLREVYFRIVQHEEKNYS DVAKEDLELFQELGIECPEEFSGKAPEINTIGYRTSQYINRICSTPWSVLVSVIIIIGLI CIASGLRWSTTGQLIANTPTMIIEEFFLLVLLQAHNWADRQRRVEVTALYARRRILLSYV EKRFPEVMMLEK
Uniprot No.

Target Background

Function
Essential for low-affinity Fe(2+) ion uptake.
Database Links

KEGG: sce:YMR319C

STRING: 4932.YMR319C

Protein Families
FET4 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the FET4 protein and what is its primary function in Saccharomyces cerevisiae?

The FET4 protein is encoded by the FET4 gene in Saccharomyces cerevisiae and functions as the low-affinity Fe(II) transport protein. It constitutes one of two distinct iron uptake systems in yeast, with the other being the high-affinity system requiring the FET3 gene. The FET4 protein is an integral membrane protein located in the plasma membrane that mediates the transport of Fe(II) ions into the cell with a lower affinity compared to the high-affinity system. This uptake system is time-, temperature-, and concentration-dependent, with a preference for Fe(II) over Fe(III) as substrate . Importantly, the protein's level closely correlates with uptake activity over a broad range of expression levels and is regulated by iron availability in the cell .

How do the high-affinity and low-affinity iron transport systems differ in yeast?

The high-affinity and low-affinity iron transport systems in Saccharomyces cerevisiae represent distinct uptake pathways with different molecular components and functional characteristics:

FeatureHigh-affinity SystemLow-affinity System
Key genesFET3, FTR1FET4
Affinity for FeHigher (μM range)Lower (mM range)
Iron preferenceFe(III)Fe(II)
RegulationStrictly regulated by iron availabilityLess tightly regulated
CompensationIncreases activity when low-affinity system is disrupted-

The high-affinity system requires the FET3 gene and functions through the Fet3p/Ftr1p ferroxidase/permease complex . In contrast, the low-affinity system operates through the FET4 gene product. Interestingly, when FET4 is disrupted, the high-affinity system increases its activity, suggesting a regulatory compensation mechanism to maintain iron homeostasis . These uptake systems represent separate pathways that collectively ensure adequate iron acquisition under varying environmental conditions.

Beyond iron transport, what other metal ions can the FET4 protein transport?

While primarily identified as an Fe(II) transporter, research has demonstrated that the FET4 protein also functions as a low-affinity copper permease. Copper is a non-competitive inhibitor of 55Fe uptake through FET4p with a Ki value of 22 μM. FET4p-dependent 67Cu uptake has been kinetically characterized with a Km of 35 μM and a Vmax of 8 pmol of copper/min per 106 cells . This dual functionality is supported by the observation that a fet4-containing strain exhibited no saturable, low-affinity copper uptake, confirming that this uptake was attributable to FET4p . Furthermore, mutant forms of FET4p that showed decreased efficiency in 55/59Fe uptake were similarly compromised in 67Cu uptake, indicating that similar amino acid residues in FET4p contribute to both transport processes . This multifunctional capacity makes FET4 an important protein for understanding metal ion homeostasis in yeast.

What is known about the structure of the FET4 protein and how does it relate to its function?

The FET4 protein has a predicted structure containing six potential transmembrane domains, consistent with its function as an integral membrane transport protein . Antibody studies against FET4 have detected two distinct protein forms with molecular masses of 63 and 68 kDa. In vitro synthesis experiments suggest that the 68-kDa form is the primary translation product, while the 63-kDa form may be generated by proteolytic cleavage of the full-length protein . This post-translational processing might play a role in regulating transporter activity.

Research on mutations affecting potential Fe(II) ligands located in the predicted transmembrane domains has shown significant alterations in the apparent Km and/or Vmax of the low-affinity system . These findings suggest direct interaction between specific residues in the transmembrane domains and the Fe(II) substrate during transport. The identification of these potential binding sites provides valuable insights into the molecular mechanisms underlying metal ion selectivity and transport efficiency of the FET4 protein.

How do mutations in the FET4 gene affect iron and copper transport kinetics?

Mutations in the FET4 gene can significantly alter the kinetic properties of both iron and copper transport, providing valuable insights into structure-function relationships of this transporter. Studies have demonstrated that specific mutations affecting potential Fe(II) ligands in the predicted transmembrane domains significantly alter the apparent Km and/or Vmax of the low-affinity iron uptake system . These mutations likely identify critical residues involved in Fe(II) binding during transport.

Similarly, mutant forms of FET4p that exhibit decreased efficiency in 55/59Fe uptake are also compromised in 67Cu uptake, indicating that common amino acid residues contribute to both transport processes . This correlation suggests a shared binding mechanism for both metal ions, despite their different chemical properties. Methodologically, these findings were established through careful kinetic analyses of metal uptake in yeast strains expressing various mutant forms of FET4, combined with protein expression studies to ensure that observed changes in transport activity were not simply due to altered protein levels.

What are the regulatory mechanisms controlling FET4 expression and activity?

The expression and activity of FET4 are regulated through multiple mechanisms to maintain appropriate iron homeostasis in yeast cells. The level of FET4 protein closely correlates with uptake activity over a broad range of expression levels and is itself regulated by iron availability . Under iron-replete conditions, expression is downregulated, while iron limitation leads to increased expression.

At the transcriptional level, FET4 regulation differs from the high-affinity iron uptake system. While genes encoding the high-affinity importer and about 20 other Fe-related proteins are regulated by the transcription factor Aft1p , FET4 appears to be under separate regulatory control. Under low-iron conditions, Aft1p moves to the nucleus where it activates target genes. Under iron-replete conditions, Aft1p is deactivated and moves into the cytosol in an iron-dependent process involving binding to the [Fe2S2]-containing Grx3/4p-Fra2p heterodimer .

Additionally, the broader cellular environment influences FET4 activity. The acidity of vacuoles plays an important role in iron homeostasis and potentially affects FET4 expression . When vacuoles become less acidic, the iron regulon is activated, potentially impacting FET4 expression as part of the cellular response to altered iron distribution.

What experimental approaches are most effective for studying FET4 protein localization and processing?

For effective study of FET4 protein localization and processing, researchers should employ a multi-faceted approach combining biochemical, genetic, and imaging techniques:

  • Antibody-based detection: Using antibodies against FET4 has successfully identified two distinct protein forms (63 and 68 kDa), revealing important information about post-translational processing . Western blotting of cellular fractions is effective for tracking both forms of the protein.

  • Subcellular fractionation: Separation of plasma membrane, vacuolar, and mitochondrial fractions followed by protein detection has confirmed that FET4 is an integral membrane protein present in the plasma membrane . This approach is essential for confirming the localization of the transporter.

  • In vitro synthesis: This technique has been valuable in determining that the 68-kDa form of FET4 is the primary translation product, while the 63-kDa form may result from proteolytic cleavage . Coupled transcription/translation systems using FET4 cDNA can verify initial translation products.

  • Fluorescent protein tagging: Though not explicitly mentioned in the provided research results, GFP-tagging of FET4 would allow for real-time visualization of protein localization and trafficking in live cells using confocal microscopy.

  • Protease protection assays: These can determine the topology of transmembrane segments and help identify which domains are exposed to either side of the membrane.

Combined, these approaches provide comprehensive insights into FET4 processing and localization, critical for understanding its function in the context of cellular metal homeostasis.

What methods are most reliable for measuring FET4-mediated iron and copper transport activity?

Reliable quantification of FET4-mediated metal transport requires specialized techniques that can distinguish between high and low-affinity transport systems. The following methodological approaches have proven effective:

  • Radioisotope uptake assays: Using 55Fe and 67Cu isotopes allows for direct measurement of metal ion transport. For iron uptake, researchers have successfully employed 55Fe to characterize transport kinetics with different FET4 variants . Similarly, 67Cu has been used to characterize copper transport parameters, yielding Km and Vmax values of 35 μM and 8 pmol of copper/min per 106 cells, respectively .

  • Genetic manipulation approach: Creating strains with disruptions in high-affinity transport systems (e.g., fet3Δ strains) enables isolation and characterization of the low-affinity FET4-dependent system without interference . This genetic approach allows researchers to study FET4 function in a cleaner background.

  • Kinetic analysis: Determining transport parameters under varying substrate concentrations and competitive inhibitor conditions has revealed important properties of FET4, including the non-competitive inhibition of iron transport by copper (Ki=22 μM) . This approach requires careful time-course measurements at different metal ion concentrations.

  • Metal-dependent phenotypic assays: Growth assays under varying metal concentrations and oxidative stress conditions can serve as indirect measures of transport activity, especially when comparing wild-type and mutant strains.

For the most comprehensive analysis, these methods should be combined with protein expression studies to correlate transport activity with FET4 protein levels.

How can researchers effectively generate and characterize recombinant FET4 protein for in vitro studies?

Generating functional recombinant FET4 protein presents challenges due to its transmembrane nature but can be accomplished through the following methodological approaches:

  • Expression system selection: Saccharomyces cerevisiae itself serves as an effective expression system for recombinant FET4, maintaining proper folding and post-translational modifications. This approach is supported by the successful production of other yeast membrane proteins like GRX2 with >90% purity .

  • Affinity tagging strategy: Adding affinity tags (His6, FLAG, etc.) at either N- or C-terminus facilitates purification while minimizing functional interference. Based on the known processing of FET4 (68 kDa primary product vs. 63 kDa processed form) , careful tag placement is essential to capture the desired form.

  • Detergent solubilization optimization: Screening multiple detergents is critical for maintaining FET4's native conformation during extraction from membranes. Given FET4's six transmembrane domains , detergents like DDM, LMNG, or digitonin would be appropriate starting points.

  • Functional validation assays: Reconstitution of purified FET4 into liposomes followed by metal uptake assays using radioactive isotopes (55Fe, 67Cu) provides the most direct confirmation of functionality. Correlating in vitro transport kinetics with the known parameters (such as the preference for Fe(II) over Fe(III) and the Km values for different metals) validates proper folding.

  • Structural characterization: Circular dichroism spectroscopy can verify secondary structure content, while limited proteolysis combined with mass spectrometry maps domain organization and accessibility.

This systematic approach balances yield with functional integrity, producing recombinant FET4 suitable for detailed biochemical and structural studies.

How does FET4 activity influence cellular iron homeostasis and distribution?

FET4 activity significantly impacts iron homeostasis through its role as the low-affinity iron transporter in the plasma membrane. Under iron-replete growth conditions (>10 μM Fe), vacuolar iron constitutes the majority of cellular iron, with mitochondrial iron comprising much of the remainder . FET4's contribution to cellular iron acquisition becomes particularly important when considering the distribution of iron pools within the cell.

Interestingly, there appears to be a regulatory relationship between the high and low-affinity iron uptake systems. When FET4 is overexpressed, high-affinity uptake activity decreases, while disrupting FET4 increases high-affinity activity . This compensatory regulation suggests that the high-affinity system may be regulated to adjust for alterations in low-affinity activity, demonstrating the interconnected nature of cellular iron homeostasis mechanisms.

The acidity of vacuoles also plays an important role in iron homeostasis and potentially influences FET4 activity. When vacuoles become less acidic, the iron regulon is activated, and additional vacuolar iron is imported . The redox state of vacuolar iron is controlled by specific reactions involving glutathione, as illustrated by the equation: 2Fe(II) + GSSG + 2H+ ⇄ 2GSH + 2Fe(III) . This redox chemistry highlights the complex interplay between cellular compartments in maintaining appropriate iron distribution and availability.

What is the relationship between FET4-mediated copper transport and other copper homeostasis mechanisms?

FET4's role in copper transport reveals a sophisticated integration with broader copper homeostasis mechanisms in yeast. Although primarily known as an iron transporter, FET4p functions as a low-affinity copper permease that complements the high-affinity copper permease Ctr1p . This dual-transport system ensures copper acquisition across varying environmental concentrations.

A key finding in understanding this relationship is that copper taken into the cell via FET4p is metabolized similarly to copper transported by the high-affinity permease, Ctr1p . This has been demonstrated through the FET4p-dependent copper activation of Fet3p, the copper oxidase that supports high-affinity iron uptake. Additionally, copper transported by FET4p down-regulates the copper-sensitive transcription factor Mac1p at intracellular concentrations comparable to those achieved via Ctr1p transport .

These observations lead to an important mechanistic insight: the initial trafficking of newly arrived copper in yeast cells appears independent of the copper uptake pathway involved. Research suggests that this copper may first enter a small "holding" pool prior to its partitioning within the cell . This pool would serve as a distribution center, directing copper to various cellular compartments and metalloproteins based on need, rather than origin. This integrated view of copper homeostasis places FET4 within a coordinated network of transporters and chaperones that collectively maintain appropriate copper levels and distribution.

How do environmental factors and metabolic conditions influence FET4 expression and function?

Environmental factors and metabolic conditions significantly modulate FET4 expression and function through multiple regulatory mechanisms. Research has revealed several key influences:

  • Iron availability: FET4 protein levels are regulated by iron availability in the cell, with expression adjusting to maintain appropriate iron homeostasis . This regulation helps yeast adapt to varying environmental iron concentrations.

  • Vacuolar acidification: The acidity of vacuoles plays an important role in iron homeostasis. When vacuoles become less acidic, the iron regulon is activated , potentially affecting FET4 expression as part of the cellular response to altered iron distribution.

  • Adenine deficiency: Interestingly, adenine deficiency appears to cause vacuoles to be more reduced, potentially affecting the redox state of vacuolar iron and consequently modulating FET4 activity . This demonstrates how metabolic conditions can indirectly influence iron transport.

  • Glucose availability: Studies with glucose-deprived cells show altered iron accumulation patterns and better post-exponential iron regulation , suggesting that carbon source availability impacts iron transport systems including FET4.

  • TOR signaling pathway: Inhibition of the Target of Rapamycin (TOR) system through rapamycin treatment results in decreased iron accumulation and better post-exponential iron regulation . Like glucose deprivation, rapamycin treatment leads to lower Fe concentrations and altered iron distribution profiles.

These findings underscore how FET4 function is integrated within broader cellular metabolic networks, allowing for adaptive responses to changing environmental and nutritional conditions to maintain metal homeostasis.

How can the FET4 system serve as a model for understanding broader principles of metal ion transport?

The FET4 system offers a powerful model for understanding fundamental principles of metal ion transport applicable across biological systems. Its ability to transport both iron and copper with different affinities provides insights into the molecular basis of metal selectivity and transport mechanisms . This dual functionality allows researchers to investigate how a single protein can accommodate different metal ions despite their distinct chemical properties.

Mutations affecting potential Fe(II) ligands in FET4's transmembrane domains significantly alter transport kinetics , offering a window into structure-function relationships critical for metal binding and translocation. These studies have helped identify key residues involved in substrate interaction, providing templates for understanding metal coordination in other transporters.

The regulatory interplay between high and low-affinity transport systems in yeast (whereby disrupting FET4 increases high-affinity iron uptake activity ) demonstrates how organisms maintain metal homeostasis through compensatory mechanisms. This model helps explain similar regulatory networks in more complex organisms, including humans.

What are the implications of FET4 research for understanding iron transport disorders in higher organisms?

Research on the FET4 low-affinity iron transport system has significant implications for understanding iron transport disorders in higher organisms, including humans. Despite obvious differences between yeast and mammalian systems, several fundamental principles of iron homeostasis are conserved:

  • Dual-affinity transport systems: Like yeast, mammalian cells employ multiple iron acquisition pathways with different affinities. The compensatory relationship between high and low-affinity systems in yeast parallels redundancy in mammalian iron uptake mechanisms, providing insights into how disorders affecting one pathway may be partially offset by others.

  • Metal transport specificity: FET4's ability to transport both iron and copper with shared binding determinants helps explain why mutations in human metal transporters often affect multiple metal homeostasis pathways. This cross-functionality is relevant to disorders like aceruloplasminemia, where disrupted copper loading affects iron export.

  • Compartmentalization and redox control: The relationship between vacuolar iron storage, redox state, and cytosolic iron availability in yeast mirrors mammalian mechanisms involving ferritin, endosomes, and mitochondria. This provides a framework for understanding conditions like neurodegeneration with brain iron accumulation, where iron is present but improperly distributed or in the wrong redox state.

  • Metabolic integration: The influence of glucose availability and TOR signaling on yeast iron homeostasis parallels mammalian iron regulation in response to metabolic states, informing research on iron disorders associated with diabetes, obesity, and metabolic syndrome.

These parallels make yeast FET4 research valuable for developing hypotheses about human iron disorders, potentially guiding therapeutic approaches targeting specific transport pathways or their regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.