Recombinant Saccharomyces cerevisiae Maintenance of telomere capping protein 4 (MTC4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
MTC4; YBR255W; YBR1723; Maintenance of telomere capping protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-694
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
MTC4
Target Protein Sequence
MTHTNEHDHKAEQQQNGRGDTTTETVNPQKMKLVTKLLIDNKFGLMDDLNFSIPLTASSE GVPISAKTSELGTEYLKNQQENSVSPILPISRSTRIKADRVRIYLDYYYNILERCISIDS SQNHHEGVEGVYNPLQVIRNRKLKKKHHELPTREFYTTKHPIIAIKQFSKKPNKKMPWFV DINEKYMDLTWRTSHWEELVDPQGKLWFQSYSPSNESSGSSSSRRHHGHHIHPRRHLQHH SRVRTANSVHSNTQSLTPKRVMTNEEDNNNHNNNNMITKIATTPEAQISRNKKSDLNLSH IHLEVPITNTVTNTSSDQGSLIIEAKGSSYGGDRRGSSNTSGSGGKRNSKHYRSKSAGPP ENEKSRMNGLEKIISKTSKGWSRSPKKNTPGLEKQVLLNPTISNGGTSRRSSNNGESIST NSSKSSMGITFGNTETYKTPVDNGKDAIIRQSLLSEVPVHTLRGKTSNRSLRAEGEQALE SDKELPNGAGSIYEGAPREKTTSQGSEPVGLVSDSLQVDEQLQRYWHDTRYIMSTVAMMQ HRRETHDIVKRREIARRNEIEITQDADTNIRKTADALTQYDNELNKVLKLGNDWTSKLLN DYSIRVETLISSSDRILSDINTTLTLKLKMFQENTERYVTVKVMRAQKMTKTIYRLLEFG IVLVLWTIWFLFSVLRSIRFTIFLVLKIIKALLW
Uniprot No.

Target Background

Database Links

KEGG: sce:YBR255W

STRING: 4932.YBR255W

Subcellular Location
Membrane; Single-pass membrane protein. Cytoplasm. Note=Punctate pattern.

Q&A

What is the known function of MTC4 in yeast cells?

MTC4 serves multiple functions in yeast cells:

  • Telomere maintenance: As its name suggests, MTC4 plays a role in telomere capping and maintenance . It functions in a pathway that prevents telomere-telomere fusions (T-TFs), which can lead to genomic instability.

  • Organellar localization shifts: Interestingly, MTC4 shows dynamic subcellular localization. It co-localizes with lipid droplets when yeast cells are grown in glucose-rich media but relocates to peroxisomes when cells are grown in oleate as the sole carbon source . This suggests MTC4 may play a role in lipid metabolism that shifts based on carbon source availability.

  • Stress response: MTC4 has been identified as important for growth in high-pressure and cold environments, indicating a role in stress adaptation .

  • Cell polarity and morphogenesis: MTC4 has been functionally associated with a cluster of genes involved in cell polarity and morphogenesis, suggesting it may contribute to cellular architecture and structural integrity .

What is the phosphorylation profile of MTC4?

MTC4 is heavily phosphorylated, with at least 22 documented phosphorylation sites according to the iPTMnet database . Key phosphorylation sites include:

SitePTM TypeSourcePMID
S83PhosphorylationSGD23749301
S85PhosphorylationBioGRID SGD UniProt33481703, 33491328, 18407956, 23749301
T263PhosphorylationSGD UniProt33481703, 32597660, 33491328, 18407956, 23749301
T283PhosphorylationBioGRID SGD33481703, 15665377, 18407956, 23749301, 32597660, 33491328
S356PhosphorylationBioGRID SGD21177495, 33491328
S481PhosphorylationBioGRID SGD UniProt33481703, 17563356, 18407956, 23749301, 19779198, 33491328
S491PhosphorylationBioGRID SGD UniProt19779198, 33481703, 33491328, 23749301

The extensive phosphorylation suggests complex regulation of MTC4 function, potentially allowing it to respond to different cellular conditions or stresses.

What is the optimal expression system for recombinant MTC4 production?

For recombinant expression of MTC4, E. coli has been successfully used as a heterologous host system . Key parameters for optimal expression include:

  • Expression vector: Constructs with N-terminal His-tags have been successfully employed for MTC4 expression and purification.

  • Host strain: Standard E. coli expression strains have proven sufficient for MTC4 expression.

  • Expression conditions:

    • Induction method: IPTG induction (concentration optimized based on specific vector system)

    • Temperature: Lower temperatures (16-20°C) post-induction may enhance proper folding

    • Duration: 4-16 hours depending on temperature

  • Protein yield: Typical yields are sufficient for biochemical and structural studies, with greater than 90% purity achievable through single-step affinity chromatography .

For researchers requiring native post-translational modifications, yeast expression systems may be preferable. Both S. cerevisiae and P. pastoris have been used to express yeast proteins with intact post-translational modifications .

What purification strategies are most effective for recombinant MTC4?

Based on published methodologies for similar yeast proteins and specific information about MTC4, the following purification strategy is recommended:

  • Affinity chromatography:

    • For His-tagged MTC4: Ni-NTA or IMAC (Immobilized Metal Affinity Chromatography)

    • Buffer conditions: Tris/PBS-based buffer, pH 8.0 containing 6% trehalose is suitable for stability

  • Additional purification steps (if higher purity is required):

    • Size exclusion chromatography to remove aggregates and obtain size-homogeneous preparations

    • Ion exchange chromatography to separate differentially phosphorylated forms

  • Storage conditions:

    • Optimal storage: -20°C/-80°C in buffer containing 50% glycerol

    • Avoid repeated freeze-thaw cycles

    • Working aliquots can be maintained at 4°C for up to one week

  • Reconstitution protocol:

    • For lyophilized protein: Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Addition of 5-50% glycerol is recommended for long-term storage stability

How can MTC4 be used to study telomere maintenance mechanisms?

MTC4's role in telomere maintenance makes it valuable for studying several aspects of telomere biology:

  • Genetic interaction studies:

    • Combining MTC4 mutations with other telomere-related gene mutations (TEL1, MEC1, DDC1, MEC3) allows investigation of genetic pathways involved in telomere maintenance

    • Creation of double mutants with genes like MRE11, RAD50, and XRS2 can reveal interactions between MTC4 and the MRX complex at telomeres

  • Telomere-telomere fusion (T-TF) assays:

    • PCR-based assays to detect telomere-telomere fusions in MTC4 mutant backgrounds can determine its role in preventing such fusions

    • Chromatin immunoprecipitation (ChIP) with telomere-specific primers can assess MTC4's localization at telomeres under various conditions

  • Telomere length regulation:

    • Southern blot analysis of telomeric restriction fragments in MTC4 mutants can reveal its impact on telomere length maintenance

    • Genetic rescue experiments with MTC4 in telomerase-deficient strains can assess its potential role in alternative telomere lengthening pathways

  • Protein-protein interaction studies:

    • Co-immunoprecipitation experiments with MTC4 and known telomere-binding proteins (Rap1p, Yku80p) can identify direct interactions

    • Systematic analysis of genetic interactions between MTC4 and genes involved in nonhomologous end joining (NHEJ) can clarify its role in preventing telomere fusions

What methods can be used to study MTC4's dual localization to peroxisomes and lipid droplets?

MTC4's unique localization pattern (peroxisomes in oleate media, lipid droplets in glucose media) presents interesting research opportunities:

  • Live-cell fluorescence imaging:

    • GFP-tagged MTC4 constructs can be co-expressed with organelle markers like Pex3-mCherry (peroxisomes) or lipid droplet markers to visualize dynamic localization changes

    • Time-lapse microscopy during media shifts can capture the kinetics of relocalization

  • Biochemical fractionation:

    • Density gradient centrifugation to isolate peroxisomal and lipid droplet fractions from cells grown in different carbon sources

    • Western blotting of fractions to quantify MTC4 distribution

  • Structure-function analysis:

    • Creation of MTC4 truncations and point mutations to identify domains responsible for differential localization

    • Mutational analysis of phosphorylation sites to determine if phosphorylation regulates localization

  • Metabolic impact assessment:

    • Lipidomic analysis of MTC4 deletion strains grown in different carbon sources

    • Assessment of β-oxidation efficiency and peroxisomal function in MTC4 mutants

A particularly effective experimental approach would combine GFP-tagging of MTC4 with automated high-content microscopy to screen for genetic or chemical factors that influence its localization pattern .

How does MTC4 interact with other proteins in its functional module?

Evidence suggests MTC4 functions as part of a novel module with other proteins including MTC2, MTC6, CSF1, DLT1, and YPR153W . To study these interactions:

  • Global genetic interaction mapping:

    • Systematic genetic interaction screens comparing interaction profiles of MTC4 with its putative module partners can confirm functional relationships

    • Quantitative measurement of these interactions can be achieved using techniques like SGA (Synthetic Genetic Array) analysis

  • Protein complex analysis:

    • Tandem affinity purification (TAP) of MTC4 followed by mass spectrometry to identify interacting partners

    • Reciprocal co-immunoprecipitation experiments to validate direct protein-protein interactions

    • Yeast two-hybrid screens to map binary interaction networks

  • Co-localization studies:

    • Multi-color fluorescence microscopy with differently tagged module components to assess spatial relationships

    • FRET (Förster Resonance Energy Transfer) analysis to detect close proximity of module components

  • Functional genomics approaches:

    • Gene expression profiling of module component deletions to identify common transcriptional signatures

    • Phenotypic profiling under various stress conditions to identify shared functions

What are the best methods to study MTC4 phosphorylation dynamics?

Given MTC4's extensive phosphorylation profile, several approaches can be used to study its phosphorylation dynamics:

  • Mass spectrometry-based phosphoproteomics:

    • SILAC (Stable Isotope Labeling with Amino acids in Cell culture) or TMT (Tandem Mass Tag) labeling to quantify changes in MTC4 phosphorylation under different conditions

    • Enrichment of phosphopeptides using TiO₂ or IMAC prior to LC-MS/MS analysis

    • Targeted approaches like Selected Reaction Monitoring (SRM) or Parallel Reaction Monitoring (PRM) for focused quantification of specific phosphosites

  • Phospho-specific antibodies:

    • Generation of antibodies against key phosphorylation sites (e.g., S85, T263, S481)

    • Western blotting to track phosphorylation changes in response to different carbon sources or stresses

  • Genetic approaches:

    • Creation of phosphomimetic (S/T→D/E) and phosphodeficient (S/T→A) mutants of key sites

    • Functional complementation assays to determine the impact of phosphorylation on MTC4 localization and function

  • Kinase and phosphatase identification:

    • In vitro kinase assays with recombinant MTC4 and candidate kinases

    • Phosphatase inhibitor studies to identify enzymes regulating MTC4 dephosphorylation

    • Chemical genetic approaches using analog-sensitive kinase mutants

How can researchers effectively create and characterize MTC4 mutant strains?

Creating and characterizing MTC4 mutants requires several methodological approaches:

  • Generation of mutants:

    • CRISPR-Cas9 genome editing for precise mutations

    • Traditional homologous recombination-based gene replacement

    • Plasmid-based expression of mutant alleles in mtc4Δ backgrounds

  • Phenotypic characterization:

    • Growth assays under various stress conditions (temperature, pressure, oxidative stress)

    • Analysis of telomere length using Southern blotting

    • PCR-based telomere fusion assays

    • Microscopic examination of cell morphology and organelle distribution

  • Molecular characterization:

    • RT-qPCR to assess effects on gene expression

    • ChIP to examine changes in telomere-associated protein complexes

    • Co-immunoprecipitation to detect altered protein-protein interactions

  • High-throughput approaches:

    • SGA analysis to map genetic interaction networks of mutants

    • Chemical genetic profiling to identify compounds with differential effects on mutants versus wild-type

    • Transcriptome analysis to identify gene expression changes

What are the unexplored aspects of MTC4 function that warrant further investigation?

Several aspects of MTC4 biology remain to be fully explored:

  • Mechanistic basis for dual localization:

    • How does MTC4 sense carbon source changes?

    • What trafficking machinery is involved in its relocalization?

    • Is post-translational modification involved in this switch?

  • Links between peroxisomal function and telomere maintenance:

    • Does MTC4 represent a novel connection between metabolic state and genome stability?

    • How does lipid metabolism influence telomere capping?

  • Role in stress adaptation:

    • Molecular mechanisms by which MTC4 contributes to survival under pressure and cold stress

    • Potential role in other stress responses not yet characterized

  • Human orthologs and disease relevance:

    • Identification of potential human orthologs based on functional rather than sequence conservation

    • Investigation of connections to human diseases involving telomere dysfunction or peroxisomal disorders

How can systems biology approaches enhance our understanding of MTC4 function?

Systems-level approaches can provide deeper insights into MTC4 function:

  • Integration of multi-omics data:

    • Combining proteomics, phosphoproteomics, transcriptomics, and metabolomics data to build comprehensive models of MTC4 function

    • Correlation of phosphorylation patterns with localization and functional changes

  • Network analysis:

    • Construction of protein-protein interaction networks centered on MTC4

    • Integration with genetic interaction data to predict functional relationships

    • Analysis of network perturbations under different conditions

  • Evolutionary analysis:

    • Comparative genomics across fungal species to identify conserved features

    • Analysis of co-evolution patterns with interacting partners

  • Mathematical modeling:

    • Kinetic models of MTC4 phosphorylation/dephosphorylation

    • Spatial models of MTC4 trafficking between organelles

    • Integration of MTC4 function into whole-cell models of yeast metabolism and stress response

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.