Recombinant Saccharomyces cerevisiae Mannosyl phosphorylinositol ceramide synthase CSH1 (CSH1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Saccharomyces cerevisiae Mannosyl Phosphorylinositol Ceramide Synthase CSH1 (CSH1)

Recombinant Saccharomyces cerevisiae Mannosyl phosphorylinositol ceramide synthase CSH1 (CSH1) is an enzyme involved in the synthesis of complex sphingolipids, specifically mannosylinositol phosphorylceramides (MIPCs), in the yeast Saccharomyces cerevisiae. This enzyme is crucial for maintaining cell wall integrity and plays a role in the coordination of sphingolipid metabolism with other cellular processes.

Function and Role of CSH1

CSH1, along with its homolog SUR1, is responsible for synthesizing MIPCs in the Golgi apparatus of S. cerevisiae. These sphingolipids are essential for cell wall integrity and interact with ergosterol to maintain the structural and functional integrity of the cell wall . The deletion of CSH1 and SUR1 genes can lead to increased phosphorylation of the mitogen-activated protein kinase Slt2, indicating a defect in cell wall integrity .

Structure and Modifications

CSH1 contains N-glycans, which are important for its enzymatic activity and stability. Specifically, CSH1 has N-glycans on Asn-51 and Asn-247. The N-glycan on Asn-51 exhibits a unique mannan-like structure, which is distinct from the typical core-type N-glycans found in intracellular proteins . These modifications play a critical role in substrate recognition and enzyme stability.

Recombinant Production

Recombinant CSH1 can be produced in various hosts, including E. coli, yeast, baculovirus, and mammalian cells, with a purity of ≥85% as determined by SDS-PAGE . This recombinant enzyme is useful for studying the biochemical properties of CSH1 and its role in sphingolipid synthesis.

Research Findings

Recent studies have highlighted the importance of CSH1 in sphingolipid metabolism and cell wall integrity. The interaction between MIPCs synthesized by CSH1 and ergosterol is crucial for maintaining cell wall function . Additionally, the unique N-glycan structures on CSH1 influence its enzymatic activity and stability, suggesting a complex regulatory mechanism for sphingolipid synthesis .

Data Table: Characteristics of Recombinant CSH1

CharacteristicDescription
Gene NameCSH1
HostsE. coli, Yeast, Baculovirus, Mammalian Cells
Purity≥85% (SDS-PAGE)
N-Glycosylation SitesAsn-51, Asn-247
FunctionSynthesis of mannosylinositol phosphorylceramides (MIPCs)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
CSH1; YBR161W; YBR1212; Mannosyl phosphorylinositol ceramide synthase CSH1; CSG1/SUR1 homolog 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-376
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
Target Protein Sequence
MKKELKILIIANIALLISIIHYTFDLLTLCIDDTSKDALTDEQLNPPNGFNSTFYESPPQ LIPKIIHQTYKTNDIPEQWVKGRQKCIDLHPDYTYILWTDEMSDTFIKQEYPWFLDTFRS YEYPIERADAIRYFILSHYGGIYIDLDDGCERRLDPLLKVPAFLRKTSPTGVSNDVMGSV PRHPFFLKVIKSLKHYKKNWYIPYMTIMGSTGPLFISVVWKQYKRWSNTAENGAVRILQP ADYKMHNNSFFSISKGSSWHTGDANFMKTLENHILSCVVTGFIFGFFILYGEFTFYTWLC SGPFNNKRYYIQWLSDKFKLHKWKLTSSYKNKEKRRNPTRHEYNSRGKRLRKDSNIPYDS VFLDIEKNHAKFTDLT
Uniprot No.

Target Background

Function

Function: Involved in the synthesis of mannosyl phosphorylinositol ceramide. Catalyzes the addition of mannose to phosphorylinositol ceramide.

Database Links

KEGG: sce:YBR161W

STRING: 4932.YBR161W

Protein Families
Glycosyltransferase 32 family
Subcellular Location
Vacuole membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.