Recombinant Saccharomyces cerevisiae Methylene-fatty-acyl-phospholipid synthase (OPI3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Saccharomyces cerevisiae Methylene-fatty-acyl-phospholipid Synthase (OPI3)

Saccharomyces cerevisiae Methylene-fatty-acyl-phospholipid synthase, commonly known as OPI3, is an enzyme that catalyzes the last two steps in phosphatidylcholine biosynthesis . It is also known as phospholipid methyltransferase . OPI3 functions as a bifunctional phosphatidyl-N-methylethanolamine N-methyltransferase/phosphatidyl-N-dimethylethanolamine N-methyltransferase .

Role in Phosphatidylcholine Biosynthesis

OPI3 plays a critical role in the synthesis of phosphatidylcholine (PC), a major phospholipid component of cell membranes . Specifically, OPI3 is responsible for the final two methylation steps in the conversion of phosphatidylethanolamine (PE) to PC . The opi3 mutants have a deficiency in the two terminal phospholipid N-methyltransferase (PLMT) activities required for the de novo synthesis of PC (phosphatidylcholine) .

Localization and Regulation of OPI3

In wild-type cells, OPI3-GFP localizes throughout the endoplasmic reticulum (ER) . Some extra diffuse staining can be observed in the vacuole, likely a result of turnover of OPI3-GFP . Plasma membrane (PM)—ER contact sites regulate the activity of the phosphatidylethanolamine N‐methyltransferase enzyme, Opi3 . Opi3 activity requires Osh3, which localizes to PM–ER contacts where it might facilitate in transcatalysis by Opi3 .

Impact of OPI3 Mutations

Mutations in the OPI3 gene can lead to several phenotypic effects . A secondary effect of opi3 mutations is disruption of the cross pathway regulation of the synthesis of the PI (phosphatidylinositol) precursor inositol . The opi3 mutants, under certain growth conditions, produce membrane virtually devoid of PC although, surprisingly, none of the mutants displays a strict auxotrophic requirement for choline .

OPI3 and Membrane Stability

The atypical membrane affects the ability of the mutant strains to initiate log phase growth and to sustain viability at stationary phase . The commencement of log phase growth is enhanced by the addition of choline or, to a lesser extent, DME (dimethylethanolamine) and retarded by the addition of MME (monomethylethanolamine) . Loss of Osh3 also caused NP-40 sensitivity, further supporting its role in regulating Opi3 at contacts .

OPI3 and PM-ER Contact Sites

PM–ER contacts regulate the activity of Opi3 through both providing its lipid substrate in trans and by restricting access of Opi3 to Osh3 at contacts . Similar to its proposed role in the regulation of Sac1, Osh3 might present PME or PE in the PM to Opi3 located at PM–ER contacts . In transmethylation by Opi3 might enable cells to rapidly adjust the PME/PE:PC ratio of the PM, affecting the physical properties of the bilayer .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to ensure contents settle. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
OPI3; PEM2; YJR073C; J1824; Phosphatidyl-N-methylethanolamine N-methyltransferase; Overproducer of inositol protein 3; Phospholipid methyltransferase; PLMT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-206
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
OPI3
Target Protein Sequence
MKESVQEIIQQLIHSVDLQSSKFQLAIVCTMFNPIFWNIVARMEYHKHSLTKMCGGARKG CYMLAATIFSLGIVRDMVYESALREQPTCSLITGENWTKLGVALFGLGQVLVLSSMYKLG ITGTYLGDYFGILMDERVTGFPFNVSNNPMYQGSTLSFLGIALYKGKPAGLVVSAVVYFM YKIALRWEEPFTAMIYANRDKAKKNM
Uniprot No.

Target Background

Function
This enzyme catalyzes the final two steps in the phosphatidylcholine biosynthesis methylation pathway: the SAM-dependent methylation of phosphatidylmonomethylethanolamine (PMME) to phosphatidyldimethylethanolamine (PDME), and subsequently, PDME to phosphatidylcholine (PC). In the absence of PE methyltransferase CHO2, it can also catalyze the initial methylation reaction converting PE to PMME.
Database Links

KEGG: sce:YJR073C

STRING: 4932.YJR073C

Protein Families
Class VI-like SAM-binding methyltransferase superfamily, PEMT/PEM2 methyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is OPI3 and what is its primary function in Saccharomyces cerevisiae?

OPI3, also known as PEM2 (Phosphatidylethanolamine Methyltransferase 2), is a gene in Saccharomyces cerevisiae that encodes the Methylene-fatty-acyl-phospholipid synthase. The name OPI3 stands for "OverProducer of Inositol," indicating its relationship to phospholipid biosynthesis pathways . This gene plays a crucial role in the final steps of phosphatidylcholine biosynthesis in yeast through the methylation pathway. The enzyme catalyzes the conversion of phosphatidylethanolamine to phosphatidylcholine through sequential methylation reactions, a critical process for maintaining proper membrane structure and function in the yeast cell.

How does OPI3 deletion affect cellular viability and phenotype?

OPI3 deletion in S. cerevisiae results in decreased mean replicative lifespan in both alpha and a strains, categorizing it as a gene necessary for fitness . The deletion mutants typically exhibit altered membrane composition due to the disruption in phospholipid biosynthesis. To properly evaluate these effects, researchers should implement controlled experimental designs that account for variables such as growth media composition, temperature, and growth phase. The experimental design must include appropriate controls (wild-type strains) and multiple biological replicates to ensure statistical validity . Measuring replicative lifespan requires specialized micromanipulation techniques to separate daughter cells from mother cells through multiple divisions.

What common methods are used to study OPI3 expression and function?

To study OPI3 expression and function, researchers typically employ a combination of the following methodological approaches:

  • Gene expression analysis: Using RT-qPCR or RNA-seq to quantify OPI3 transcript levels under various conditions

  • Protein localization: Employing GFP-tagging or immunofluorescence microscopy to visualize OPI3 localization

  • Genetic manipulation: Creating deletion mutants, point mutations, or overexpression strains using CRISPR-Cas9 or traditional homologous recombination methods

  • Phenotypic assays: Measuring growth rates, stress resistance, and membrane integrity

  • Lipidomic analysis: Quantifying phospholipid composition changes using mass spectrometry

When designing such experiments, researchers should incorporate a PEO framework (Population, Exposure, Outcome) to maintain research focus . For instance:

ElementDefinitionOPI3 Research Example
PopulationThe specific strain or condition being studiedWild-type and OPI3 deletion S. cerevisiae
ExposureThe variable being testedGrowth under different carbon sources
OutcomeThe measured responsePhospholipid profile changes

How does OPI3 contribute to fatty acid metabolism and what methodologies best capture this relationship?

While OPI3 primarily functions in phospholipid biosynthesis, its activity indirectly influences fatty acid metabolism in S. cerevisiae. To investigate this relationship, researchers should implement a multi-omics approach combining:

  • Metabolic flux analysis: Tracking carbon flow through central metabolism and lipid biosynthesis pathways using isotope labeling

  • Comparative proteomics: Identifying changes in fatty acid synthesis enzymes between wild-type and OPI3 mutants

  • Genetic interaction screening: Assessing synthetic interactions between OPI3 and genes involved in fatty acid synthesis

When studying fatty acid production in yeast systems, researchers have achieved extracellular concentrations of short-chain fatty acids (SCFAs) up to 464 mg/l without additional pathway engineering . This suggests potential crosstalk between phospholipid biosynthesis and fatty acid production pathways. Experimental designs should control for carbon source availability, aeration conditions, and growth phase to isolate the specific effects of OPI3 manipulation.

What experimental approaches are most effective for studying the impact of OPI3 on yeast longevity?

To rigorously investigate OPI3's impact on yeast longevity, researchers should implement a comprehensive experimental framework:

  • Replicative lifespan assays: Track the number of daughter cells produced by individual mother cells using micromanipulation techniques

  • Chronological lifespan assays: Measure the survival of non-dividing populations in stationary phase over time

  • Molecular markers of aging: Assess accumulation of damaged proteins, changes in mitochondrial morphology, and telomere length

Based on existing data, OPI3 deletion decreases mean replicative lifespan in both mating types , suggesting it plays a necessary role in maintaining normal aging processes. When designing aging experiments, researchers should employ the SPIDER framework to ensure methodological rigor :

ElementDefinitionOPI3 Aging Research Example
SampleGroup being studiedWild-type and OPI3 mutant yeast cells
Phenomenon of InterestBehavior/decisions being investigatedCellular aging processes
DesignResearch methodologyLongitudinal replicative lifespan tracking
EvaluationOutcome measuresNumber of divisions completed
Research typeMethodological approachMixed methods (quantitative counts + qualitative morphology)

How can researchers address contradictory findings in OPI3 functional studies?

When confronted with contradictory findings regarding OPI3 function, researchers should implement a systematic approach to reconcile discrepancies:

  • Standardize experimental conditions: Ensure that growth media, temperature, strain background, and cell density are consistent across studies

  • Implement blinded analysis: Reduce confirmation bias by having data analyzed by researchers unaware of expected outcomes

  • Quantify result variability: Apply statistical methods to determine if contradictions fall within expected experimental variation

  • Cross-validate with multiple techniques: Confirm findings using independent methodological approaches

When evaluating contradictory evidence, researchers should systematically identify potential sources of contradiction using a structured framework similar to those used in evaluating self-contradictions in documents . This includes examining:

  • Methodological differences: Variations in techniques, reagents, or equipment

  • Strain background effects: Genetic differences beyond the target gene

  • Environmental variables: Subtle differences in growth conditions

  • Data interpretation approaches: Different statistical methods or thresholds

What are the optimal conditions for recombinant expression of OPI3 for structural and functional studies?

For successful recombinant expression of OPI3, researchers should consider the following methodological approaches:

  • Expression system selection: While homologous expression in S. cerevisiae maintains native folding and post-translational modifications, heterologous expression in E. coli or P. pastoris may yield higher protein quantities

  • Codon optimization: Adjust codon usage based on the expression host to enhance translation efficiency

  • Fusion tag strategy: N-terminal or C-terminal tags (His6, GST, MBP) can improve solubility and facilitate purification, but may affect enzyme activity

  • Induction conditions: Optimize temperature, inducer concentration, and expression duration to balance yield and proper folding

When designing expression experiments, researchers should implement a systematic screening approach:

ParameterVariables to TestMeasurement
Expression hostS. cerevisiae, P. pastoris, E. coliProtein yield, activity
Growth temperature16°C, 25°C, 30°C, 37°CSoluble vs. insoluble fraction
Induction timingEarly log, mid-log, late log phaseExpression level, toxicity
Purification methodIMAC, ion exchange, size exclusionPurity, activity retention

How should researchers design experiments to investigate OPI3's role in phospholipid composition?

When investigating OPI3's role in phospholipid composition, researchers should implement a comprehensive experimental design that follows these methodological principles:

  • Genotype verification: Confirm OPI3 deletion or modification using both PCR and functional complementation

  • Growth standardization: Ensure cultures are harvested at consistent growth phases, as phospholipid composition varies with cell cycle

  • Extraction protocol optimization: Use appropriate solvent systems (chloroform/methanol) and internal standards for quantitative analysis

  • Analytical approach selection: Combine thin-layer chromatography for initial profiling with mass spectrometry for detailed composition analysis

This research question aligns with the PICO framework for structured investigation :

ElementDefinitionOPI3 Phospholipid Research Example
PopulationSubject of studyS. cerevisiae strains
InterventionExperimental manipulationOPI3 deletion or controlled expression
ComparisonReference conditionWild-type cells or complemented mutants
OutcomeMeasured resultsChanges in phospholipid species composition

What technical challenges must be addressed when studying OPI3 in relation to fatty acid synthesis engineering?

Engineering fatty acid synthesis in relation to OPI3 function presents several technical challenges that researchers must address through careful methodological approaches:

  • Toxicity management: Short-chain fatty acids can inhibit growth at high concentrations, requiring controlled expression systems or adaptive evolution approaches

  • Flux balance: Redirecting metabolic flux toward fatty acid synthesis without disrupting essential phospholipid biosynthesis requires careful pathway engineering

  • Analytical methods: Accurately quantifying both intracellular and secreted fatty acids requires optimized extraction protocols and appropriate analytical standards

Previous research has achieved extracellular concentrations of short-chain fatty acids (mainly C6-FA and C8-FA) of 464 mg/l in total through fatty acid synthase engineering in S. cerevisiae . When attempting to engineer fatty acid production while manipulating OPI3, researchers should implement a systematic experimental design that accounts for potential metabolic cross-talk between pathways.

How can researchers overcome common challenges in OPI3 functional studies?

When conducting OPI3 functional studies, researchers frequently encounter several challenges that can be addressed through specific methodological approaches:

  • Growth defects in deletion strains: Implement chemically defined media supplementation strategies to compensate for metabolic deficiencies

  • Enzyme assay limitations: Develop in vitro reconstitution systems with purified components to isolate specific activities

  • Pleiotropic effects: Utilize conditional expression systems (tetracycline-regulatable promoters) to separate direct from indirect effects

  • Conflicting results interpretation: Apply a structured framework for analyzing contradictory data , including:

    • Systematically documenting experimental conditions

    • Quantifying statistical significance of differences

    • Isolating variables that may contribute to disparate results

When contradictory results emerge regarding OPI3 function, researchers should implement the following analytical framework:

Contradiction TypeAnalysis ApproachResolution Strategy
Phenotypic differencesStrain background comparisonGenetic complementation testing
Enzymatic activity variationBuffer and substrate standardizationPurified protein with defined conditions
Localization discrepanciesFixation method evaluationMultiple tagging strategies
Growth condition responsesSystematic media component testingFactorial experimental design

What statistical approaches are most appropriate for analyzing OPI3 mutant phenotypes?

When analyzing phenotypic data from OPI3 mutant studies, researchers should select statistical methods that accommodate the specific characteristics of their experimental design:

  • Growth curve analysis: Apply area under the curve (AUC) or doubling time calculations with appropriate confidence intervals

  • Lifespan comparisons: Implement Kaplan-Meier survival analysis with log-rank tests for significance

  • Lipid composition changes: Use multivariate approaches (PCA, PLS-DA) to identify patterns across multiple lipid species

  • Gene expression correlations: Apply false discovery rate corrections for multiple testing when analyzing transcriptomic responses

For all analyses, researchers should adhere to the fundamental principles of experimental research design , including appropriate controls, sufficient replication, and careful variable isolation. When comparing wild-type and OPI3 mutant strains across multiple conditions, factorial design approaches with ANOVA or mixed-effects models are typically most appropriate.

What emerging technologies could advance our understanding of OPI3 function and regulation?

Several cutting-edge technologies show promise for deepening our understanding of OPI3 function and regulation in S. cerevisiae:

  • CRISPR interference/activation: Allowing precise modulation of OPI3 expression levels rather than binary presence/absence

  • Single-cell lipidomics: Revealing cell-to-cell variation in phospholipid composition responses to OPI3 manipulation

  • Cryo-EM structural analysis: Determining enzyme structure and substrate binding mechanisms at near-atomic resolution

  • Proximity labeling proteomics: Identifying protein interaction partners in native cellular contexts

  • Synthetic genetic array analysis: Mapping genetic interaction networks across the genome to position OPI3 in broader cellular processes

When implementing these technologies, researchers should maintain rigorous experimental design principles , including appropriate controls, sufficient replication, and careful isolation of variables. The combination of these approaches within a unified research program offers the potential to resolve current contradictions and develop a comprehensive model of OPI3 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.