Recombinant Saccharomyces cerevisiae Methylsterol monooxygenase (ERG25)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Saccharomyces cerevisiae Methylsterol Monooxygenase (ERG25)

Saccharomyces cerevisiae Methylsterol Monooxygenase, commonly known as ERG25, is an enzyme critical in sterol biosynthesis . Specifically, it functions as a C-4 sterol methyl oxidase, catalyzing the initial step in removing two C-4 methyl groups during the production of cholesterol (in animals), ergosterol (in fungi), and stigmasterol (in plants) .

Functional Role and Mechanism

ERG25 facilitates the conversion of 4,4-dimethylzymosterol to 4-methylzymosterol . This demethylation process is essential for producing ergosterol, a primary sterol in fungal cell membranes that maintains membrane integrity and influences cell growth, stress response, and drug susceptibility .

Gene Cloning and Characterization

The ERG25 gene in Saccharomyces cerevisiae encodes a 309-amino acid polypeptide with a calculated molecular mass of 36.48 kDa . The amino acid sequence contains a C-terminal endoplasmic reticulum retrieval signal (KKXX) and three histidine-rich clusters, motifs commonly found in eukaryotic membrane desaturases, bacterial alkane hydroxylases, and xylene monooxygenases .

Impact on Antifungal Susceptibility and Drug Tolerance

Disruptions or mutations in ERG25 can lead to significant changes in how fungi respond to antifungal drugs . For example, Candida glabrata ERG25 is essential for cholesterol uptake from host serum, which decreases susceptibility to antifungals that inhibit ergosterol biosynthesis .

  • Azole Tolerance and Resistance: Inactivation or single allele dysfunction of ERG25 in Candida albicans can lead to azole tolerance. This tolerance is further enhanced when combined with chromosome aneuploidies .

  • Compensatory Mechanisms: When ERG251 (a paralog in Candida albicans) is inactivated, ERG25 expression increases, suggesting a compensatory mechanism to maintain sterol biosynthesis .

  • Alternative Sterol Pathways: Deletion mutants of ERG251 upregulate alternative sterol pathways, promoting survival in the presence of fluconazole (FLC) .

Role in Virulence and Stress Response

ERG25 influences fungal virulence and response to various stresses .

  • Decreased Virulence: Homozygous deletion of ERG251 in Candida albicans results in decreased virulence in systemic infections, while heterozygous deletion mutants maintain their pathogenicity .

  • Stress Responses: Dysfunction of ERG251 affects cell wall, osmotic, and oxidative stress responses .

  • Filamentation: The A allele of ERG251 (ERG251-A) plays a dominant role in regulating filamentation in the SC5314 genetic background of Candida albicans .

Interaction with Other Genes and Proteins

  • Aus1p: ERG25 is required for the plasma membrane localization of the sterol importer Aus1p, influencing cholesterol uptake .

  • ZRT2: Dysfunction of ERG251 results in transcriptional upregulation of ZRT2, a zinc transporter, which contributes to azole tolerance .

  • ERG6: Expression of ERG6 increases in ERG251 deletion mutants exposed to FLC, leading to the accumulation of alternative sterols and promoting cell survival .

ERG25 in Vascular Cells

ERG25 is expressed in vascular cells and its regulation is influenced by LDL (Low-Density Lipoprotein) . This suggests a potential role in cholesterol metabolism within these cells .

Table 1: Effects of ERG251 Dysfunction on Gene Expression in Candida albicans

GeneConditionLog2 Fold Change (ΔA vs. WT)Log2 Fold Change (ΔB vs. WT)
ERG6YPADIncreasedIncreased
ERG251YPADDecreasedDecreased
CRZ2YPADIncreasedIncreased
ERG25FLC (1µg/ml)IncreasedIncreased

Table 2: Phenotypic Impact of ERG251 Deletion in Candida albicans

PhenotypeERG251/ ERG251 (Wild Type)erg251Δ/ ERG251ERG251/ erg251Δerg251Δ/ erg251Δ
Azole ToleranceNoYesYesNo
Fitness in Rich MediaNormalNormalNormalDecreased
VirulenceNormalNormalNormalDecreased
FilamentationNormalDefectNormalNormal

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ERG25; FET6; YGR060W; Methylsterol monooxygenase; C-4 methylsterol oxidase; Sterol-C4-methyl oxidase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
ERG25
Target Protein Sequence
MSAVFNNATLSGLVQASTYSQTLQNVAHYQPQLNFMEKYWAAWYSYMNNDVLATGLMFFL LHEFMYFFRCLPWFIIDQIPYFRRWKLQPTKIPSAKEQLYCLKSVLLSHFLVEAIPIWTF HPMCEKLGITVEVPFPSLKTMALEIGLFFVLEDTWHYWAHRLFHYGVFYKYIHKQHHRYA APFGLSAEYAHPAETLSLGFGTVGMPILYVMYTGKLHLFTLCVWITLRLFQAVDSHSGYD FPWSLNKIMPFWAGAEHHDLHHHYFIGNYASSFRWWDYCLDTESGPEAKASREERMKKRA ENNAQKKTN
Uniprot No.

Target Background

Function

This enzyme catalyzes the three-step monooxygenation required for the demethylation of 4,4-dimethyl and 4α-methylsterols, enabling their subsequent metabolism to ergosterol.

Database Links

KEGG: sce:YGR060W

STRING: 4932.YGR060W

Protein Families
Sterol desaturase family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is the biochemical function of ERG25 in Saccharomyces cerevisiae?

ERG25 encodes C-4 methyl sterol oxidase, which catalyzes the first of three sequential steps required to remove two C-4 methyl groups from sterol intermediates during ergosterol biosynthesis in yeast . Specifically, ERG25 performs three sequential oxidation reactions:

  • Conversion of 4α-methyl-zymosterol to 4α-hydroxymethyl-5α-cholesta-8,24-dien-3β-ol

  • Conversion of 4α-hydroxymethyl-5α-cholesta-8,24-dien-3β-ol to 4α-formyl-5α-cholesta-8,24-dien-3β-ol

  • Conversion of 4α-formyl-5α-cholesta-8,24-dien-3β-ol to 4α-carboxy-5α-cholesta-8,24-dien-3β-ol

Each of these reactions requires molecular oxygen and reduced cytochrome b as cofactors. The enzyme functions within the ergosterol biosynthesis pathway, which is essential for maintaining proper membrane fluidity and permeability in fungi .

What is the structural characterization of ERG25?

ERG25 in S. cerevisiae encodes a 309-amino acid polypeptide with a calculated molecular mass of 36.48 kDa . The protein sequence contains several notable structural features:

  • A C-terminal endoplasmic reticulum retrieval signal (KKXX motif) that maintains localization in the ER membrane

  • Three histidine-rich clusters that show similarity to those found in eukaryotic membrane desaturases and bacterial monooxygenases (alkane hydroxylase and xylene monooxygenase)

  • Metal binding motifs similar to those in membrane desaturases-hydroxylases, which are likely involved in catalytic function

Western blot analysis using antibodies against an Erg25-GST fusion protein has detected two forms of the protein: a 34 kDa form and a 75 kDa form. Both proteins are membrane-bound and contain a single N-glycosyl unit, with immunofluorescence data suggesting localization in both the endoplasmic reticulum and plasma membrane .

How does ERG25 relate to homologous proteins in other organisms?

ERG25 shares functional homology with methyl sterol oxidases in various organisms, forming part of a conserved pathway for sterol biosynthesis:

  • In humans, a homologue of ERG25 has been identified, cloned, sequenced, and mapped to chromosome 4q32-34. This suggests evolutionary conservation of the sterol biosynthesis pathway from fungi to humans .

  • In Candida albicans, ERG251 functions as the primary C-4 sterol methyl oxidase of the alternative sterol pathway, with ERG25 existing as a paralog that is normally expressed at lower levels than ERG251 .

  • The histidine-rich clusters found in ERG25 show similarity to those in bacterial monooxygenases, suggesting a conserved catalytic mechanism across different enzyme families involved in oxidation reactions .

The conservation of this enzyme across different organisms underscores its fundamental importance in sterol metabolism and membrane biogenesis.

What are the optimal conditions for expressing recombinant ERG25 in heterologous systems?

When expressing recombinant S. cerevisiae ERG25 in heterologous systems, several methodological considerations are crucial:

  • Expression System Selection:

    • E. coli systems often result in inclusion body formation due to the membrane-associated nature of ERG25

    • Yeast-based expression systems (S. cerevisiae or P. pastoris) typically provide better results due to appropriate post-translational modifications

    • Insect cell/baculovirus systems can be effective for generating properly folded, active enzyme

  • Construct Design:

    • Include the complete 930 bp open reading frame encoding the 309 amino acid protein

    • Consider adding a C-terminal purification tag that won't interfere with the KKXX ER retrieval signal

    • For membrane extraction studies, preserve the histidine-rich clusters essential for catalytic activity

  • Cultivation Parameters:

    • Growth at 30°C is optimal for expression in yeast systems

    • Consider iron supplementation in media as ERG25 activity has shown relationship to iron availability, though transcription is not directly iron-regulated

    • Monitor ergosterol pathway flux during expression to prevent toxicity from sterol intermediate accumulation

Purification typically requires careful membrane solubilization with mild detergents followed by affinity chromatography, with enzyme activity often requiring reconstitution in appropriate lipid environments to restore native catalytic function.

How can researchers accurately measure the enzymatic activity of recombinant ERG25?

Measuring the enzymatic activity of recombinant ERG25 requires specialized analytical techniques:

  • Substrate Preparation:

    • The natural substrate, 4α-methyl-zymosterol, must be prepared from yeast strains with blocks in the ergosterol pathway

    • Alternatively, radiolabeled (³H or ¹⁴C) synthetic substrates can be used for higher sensitivity

  • Reaction Conditions:

    • Buffer composition: typically 50-100 mM phosphate or Tris-HCl (pH 7.2-7.5)

    • Required cofactors: molecular oxygen, NADPH, and a cytochrome b electron donor system

    • Optimal temperature: 30°C for yeast ERG25

  • Activity Measurement Methods:

    • Chromatographic Analysis:

      • GC-MS or LC-MS/MS to quantify substrate consumption and product formation

      • HPLC with UV detection for monitoring sterol intermediates

    • Spectrophotometric Assays:

      • Monitoring NADPH oxidation at 340 nm as an indirect measure of activity

      • Oxygen consumption measurement using oxygen electrodes

  • Data Analysis:

    • Calculate enzyme kinetic parameters (Km, Vmax) for all three sequential reactions

    • Evaluate potential product inhibition effects

The most reliable assessment combines multiple analytical approaches, as ERG25 catalyzes three sequential oxidation reactions that must be monitored independently to fully characterize enzymatic function .

What strategies can be employed to study the membrane topology and subcellular localization of ERG25?

Understanding ERG25's membrane topology and subcellular localization requires a multifaceted approach:

  • Computational Prediction:

    • Hydropathy profile analysis to identify transmembrane domains

    • Topology prediction algorithms to determine orientation of protein segments

  • Biochemical Approaches:

    • Protease Protection Assays:

      • Treat intact microsomes with proteases to determine exposed protein regions

      • Compare proteolytic patterns before and after membrane permeabilization

    • Chemical Modification:

      • Use membrane-impermeable reagents to label exposed residues

      • Mass spectrometry to identify modified sites

  • Fluorescence Microscopy:

    • GFP-tagging strategies (N-terminal vs. C-terminal) to visualize localization

    • Co-localization with established ER and plasma membrane markers

    • Live-cell imaging to monitor trafficking between compartments

  • Immunological Methods:

    • Generate antibodies against specific domains of ERG25

    • Immunofluorescence under permeabilizing and non-permeabilizing conditions

    • Immunogold electron microscopy for high-resolution localization

Previous research has demonstrated that ERG25 primarily localizes to the endoplasmic reticulum, consistent with its KKXX ER retrieval signal, but a portion also localizes to the plasma membrane . This dual localization may reflect different functional roles or trafficking dynamics that warrant further investigation.

How does ERG25 integrate with other enzymes in the ergosterol biosynthesis pathway?

ERG25 functions as part of a coordinated enzyme network in the ergosterol biosynthesis pathway:

  • Pathway Position:

    • ERG25 catalyzes reactions after the formation of 4,4-dimethylzymosterol

    • It works in sequential coordination with ERG26 (C-4 decarboxylase) and ERG27 (3-keto reductase) to remove both C-4 methyl groups

  • Metabolic Flux Control:

    • ERG25 activity serves as a potential rate-limiting step in sterol demethylation

    • The enzyme appears to be regulated by end products of the ergosterol pathway rather than by iron availability, despite its dependence on iron for catalytic function

  • Interaction Network:

    EnzymeInteraction TypeFunctional Significance
    ERG26Sequential actionDecarboxylates ERG25's product
    ERG27Physical/functionalForms complex for efficient C-4 demethylation
    ERG11RegulatoryAzole targeting of ERG11 affects ERG25 substrate availability
    ERG24Preceding enzymeProvides substrate precursors
  • Regulatory Mechanisms:

    • Post-translational modifications (likely glycosylation) as evidenced by the detection of both 34 kDa and 75 kDa forms of the protein

    • Transcriptional regulation potentially linked to sterol intermediate accumulation

Understanding these interactions is crucial for interpreting phenotypes of ERG25 mutations and for designing experiments that accurately reflect pathway dynamics rather than isolated enzyme activities.

What are the implications of ERG25 mutations for antifungal drug development?

ERG25 represents a promising but complex target for antifungal development:

  • Target Validation:

    • ERG25 is essential for viability in S. cerevisiae, as demonstrated by the non-viability of disruption mutants

    • It plays a crucial role in ergosterol biosynthesis, an established target pathway for antifungal agents

  • Resistance Mechanism Insights:

    • In Candida albicans, research on the ERG25 paralog ERG251 revealed that its dysfunction leads to azole tolerance through accumulation of non-toxic alternative sterols

    • Single allele dysfunction of ERG251 has been identified as a recurrent mechanism of acquired azole tolerance

  • Structure-Activity Relationships:

    • The histidine-rich clusters in ERG25 provide potential binding sites for metal-chelating inhibitors

    • Inhibitors targeting ERG25 would likely need to be fungal-specific to avoid affecting the human homologue

  • Synergistic Drug Approaches:

    • Targeting ERG25 in combination with other ergosterol pathway enzymes might enhance efficacy

    • Combining ERG25 inhibitors with iron chelators could potentially provide synergistic effects based on the enzyme's relationship with iron metabolism

Researchers exploring ERG25 as an antifungal target should consider the potential for resistance development and cross-resistance with existing azole antifungals, as demonstrated by studies on related enzymes in pathogenic fungi .

How can gene editing techniques be applied to study ERG25 function in vivo?

Modern gene editing approaches offer powerful tools for investigating ERG25 function:

  • CRISPR-Cas9 Applications:

    • Domain-Specific Mutations:

      • Target the histidine-rich clusters to assess their role in catalytic function

      • Modify the ER retrieval signal to investigate localization requirements

    • Promoter Engineering:

      • Create conditional expression systems to regulate ERG25 levels

      • Introduce reporter elements to monitor expression dynamics

  • Heterologous Complementation:

    • Express human or pathogenic fungal homologues in S. cerevisiae erg25 mutants

    • Assess functional conservation and species-specific differences

    • Evaluate the impact of specific mutations identified in drug-resistant clinical isolates

  • Experimental Design Considerations:

    • Given that ERG25 is essential, use plasmid shuffling techniques with URA3-marked wild-type copies

    • Implement degron-based systems for conditional protein depletion

    • Consider dual targeting of ERG25 and its paralog when working in organisms like C. albicans

  • Phenotypic Analysis Framework:

    Mutation TypeExpected PhenotypeAnalytical Method
    Catalytic siteSterol intermediate accumulationGC-MS sterol profiling
    Localization signalMislocalization, altered functionMicroscopy + lipid analysis
    Regulatory regionExpression level changesqRT-PCR, Western blot
    Humanized chimerasAltered drug sensitivityMIC determinations

When designing gene editing experiments, researchers should account for the potential lethality of complete ERG25 dysfunction and consider the use of heterozygous mutations or partial function alleles to investigate aspects of enzyme function that might be masked in null mutants .

What are common challenges in purifying active recombinant ERG25 and how can they be addressed?

Purifying active recombinant ERG25 presents several technical challenges:

  • Membrane Protein Solubilization:

    • Challenge: ERG25's membrane association makes it difficult to extract in active form

    • Solution: Screen detergents systematically (DDM, CHAPS, digitonin) at different concentrations and temperature conditions to identify optimal solubilization conditions that maintain native conformation

  • Maintaining Enzymatic Activity:

    • Challenge: Loss of activity during purification due to cofactor dissociation

    • Solution: Supplement buffers with stabilizing agents such as glycerol (10-20%), ensure presence of reducing agents, and consider including lipids that mimic the native membrane environment

  • Aggregation Issues:

    • Challenge: Tendency to form aggregates during concentration steps

    • Solution: Use sucrose gradient centrifugation, size exclusion chromatography under optimized buffer conditions, and carefully control protein concentration throughout purification

  • Co-factor Requirements:

    • Challenge: ERG25 requires iron and electron transfer systems for activity

    • Solution: Include appropriate metal ions in purification buffers and reconstitute with cytochrome b for activity assays

  • Recommended Purification Protocol Outline:

    StepMethodCritical Parameters
    ExpressionYeast or insect cell systemTemperature, induction timing
    Membrane isolationDifferential centrifugationBuffer composition, protease inhibitors
    SolubilizationMild detergent treatmentDetergent:protein ratio, time, temperature
    Affinity purificationHis-tag or alternative tagImidazole concentration, flow rate
    Activity preservationReconstitution in liposomesLipid composition, protein:lipid ratio

For meaningful functional studies, researchers should verify enzyme activity after purification using multiple complementary assays rather than relying solely on protein purity assessments .

How can researchers accurately analyze the complex sterol profiles resulting from ERG25 manipulation?

Analysis of sterol profiles requires sophisticated analytical approaches:

  • Sample Preparation:

    • Extraction Protocol:

      • Alkaline hydrolysis of yeast cells to release sterols

      • Liquid-liquid extraction with non-polar solvents (hexane, petroleum ether)

      • Saponification to remove esterified sterols when analyzing free sterols

    • Derivatization:

      • TMS (trimethylsilyl) derivatization for GC-MS analysis

      • Appropriate internal standards for quantification

  • Analytical Techniques:

    • GC-MS Analysis:

      • Use of DB-5MS or similar columns for sterol separation

      • Selected Ion Monitoring (SIM) for targeted analysis of known intermediates

      • Full scan mode for discovery of unexpected sterol species

    • LC-MS/MS Approaches:

      • Reverse phase chromatography with C18 columns

      • Multiple Reaction Monitoring (MRM) for specific sterol transitions

      • High-resolution MS for accurate mass determination

  • Data Interpretation Challenges:

    • Challenge: Complex sterol profiles with multiple isomeric compounds

    • Solution: Use authentic standards when available, rely on established fragmentation patterns, and compare retention indices

  • Key Sterol Intermediates to Monitor:

    Sterolm/z (as TMS derivative)Biological Significance
    4,4-dimethylzymosterol498Substrate accumulation indicates ERG25 deficiency
    4α-hydroxymethyl-5α-cholesta-8,24-dien-3β-ol514First reaction product
    4α-formyl-5α-cholesta-8,24-dien-3β-ol512Second reaction product
    4α-carboxy-5α-cholesta-8,24-dien-3β-ol528Third reaction product
    Ergosterol468Final pathway product indicates complete flux

When analyzing results, researchers should consider that changes in sterol profiles might induce compensatory adaptations in membrane composition, including altered phospholipid profiles and fatty acid composition, which may require complementary lipidomic analyses for comprehensive interpretation .

What approaches can be used to investigate ERG25 interactions with other proteins in the ergosterol biosynthesis pathway?

Investigating protein-protein interactions involving ERG25 requires specialized techniques:

  • In Vivo Approaches:

    • Split-Protein Complementation Assays:

      • BiFC (Bimolecular Fluorescence Complementation) to visualize interactions

      • Split-ubiquitin assays specifically designed for membrane protein interactions

    • FRET/BRET Analysis:

      • Fluorescence or bioluminescence resonance energy transfer between ERG25 and potential partners

      • Live cell imaging to monitor interaction dynamics

    • Co-immunoprecipitation with Membrane Adaptations:

      • Crosslinking prior to solubilization to preserve transient interactions

      • Tandem affinity purification with optimized detergent conditions

  • In Vitro Methods:

    • Reconstituted Systems:

      • Co-reconstitution of purified ERG25 with other ergosterol pathway enzymes in liposomes

      • Activity assays to assess functional coupling

    • Surface Plasmon Resonance:

      • Immobilization strategies adapted for membrane proteins

      • Direct measurement of binding kinetics and affinities

  • Genetic Interaction Mapping:

    • Synthetic genetic array analysis to identify functional interactions

    • Dosage suppression screens to identify proteins that can compensate for ERG25 defects

  • Integrative Structural Biology:

    • Cryo-EM analysis of purified complexes

    • Crosslinking mass spectrometry to identify interaction interfaces

    • Computational modeling informed by experimental constraints

Previous research suggests potential functional coupling between ERG25, ERG26, and ERG27 in the C-4 demethylation complex. Additionally, the relationship between ERG25 and its paralog (as seen with ERG251 and ERG25 in C. albicans) warrants investigation, as the inability to delete both genes simultaneously suggests functional compensation between these enzymes . These interaction studies provide crucial insight into the organization of the ergosterol biosynthesis pathway as a potential multienzyme complex rather than a series of independent catalytic steps.

How might systems biology approaches enhance our understanding of ERG25's role in cellular metabolism?

Systems biology offers powerful frameworks for contextualizing ERG25 function:

  • Metabolic Flux Analysis:

    • Use isotope labeling to trace carbon flow through the ergosterol pathway

    • Quantify how ERG25 activity affects global metabolic redistributions

    • Model the impact of ERG25 inhibition on cellular energy requirements

  • Multi-omics Integration:

    • Combine transcriptomics, proteomics, and lipidomics data from ERG25 mutants

    • Identify compensatory mechanisms and regulatory networks

    • Map the ripple effects of ERG25 dysfunction on cell wall organization, stress responses, and other cellular processes

  • Computational Modeling:

    • Develop kinetic models of the complete ergosterol pathway

    • Simulate the impact of ERG25 mutations on sterol homeostasis

    • Predict emergent properties from ERG25 interactions with other pathway components

  • Network Analysis Framework:

    Data TypeAnalysis ApproachExpected Insights
    TranscriptomeCo-expression networksRegulatory connections
    MetabolomeCorrelation analysisPathway crosstalk
    Genetic interactionsEpistasis mappingFunctional relationships
    PhenomeMulti-parameter phenotypingPhysiological impacts

The integration of these approaches promises to reveal how ERG25 functions within the broader context of cellular metabolism, potentially uncovering unexpected connections to other pathways and providing a more comprehensive understanding of sterol metabolism regulation .

What comparative genomic insights might be gained from studying ERG25 homologues across fungal species?

Comparative genomic analysis of ERG25 across fungal species offers valuable evolutionary and functional insights:

  • Sequence Conservation Patterns:

    • Identify absolutely conserved residues likely essential for catalytic function

    • Map variable regions that might confer species-specific regulation or substrate preferences

    • Trace the evolutionary history of gene duplications (as seen with ERG25/ERG251 in C. albicans)

  • Structure-Function Relationship:

    • Correlate natural sequence variations with differences in sterol profiles

    • Identify potential adaptive changes in pathogenic fungi

    • Predict functional consequences of polymorphisms identified in clinical isolates

  • Regulatory Element Analysis:

    • Compare promoter architectures across species to identify conserved regulatory motifs

    • Map the evolution of transcriptional networks controlling sterol biosynthesis

    • Identify species-specific regulatory mechanisms

  • Taxonomic Distribution Analysis:

    Fungal GroupERG25 FeaturesFunctional Implications
    SaccharomycotinaSingle copy in most speciesCore metabolic function
    Candida speciesGene duplication (ERG25/ERG251)Functional specialization
    Filamentous fungiVariable copy numberPotential metabolic adaptations
    BasidiomycetesDivergent sequencesAlternative catalytic mechanisms

This comparative approach can reveal how evolutionary pressures have shaped ERG25 function across fungal lineages, providing insights into adaptation mechanisms and potentially identifying lineage-specific vulnerabilities that could be exploited for antifungal development .

How can structural biology approaches advance our understanding of ERG25 catalytic mechanism?

Structural biology techniques can provide critical insights into ERG25 function:

  • Structural Determination Strategies:

    • Cryo-EM:

      • Single-particle analysis of purified ERG25

      • Visualization of potential multi-enzyme complexes

      • Conformational states during catalytic cycle

    • X-ray Crystallography:

      • Lipidic cubic phase crystallization for membrane proteins

      • Co-crystallization with substrates or inhibitors

      • Structure determination of soluble domains

    • NMR Spectroscopy:

      • Solution NMR of isolated domains

      • Solid-state NMR to study membrane-embedded regions

      • Dynamics analysis of catalytically important regions

  • Computational Approaches:

    • Homology modeling based on related monooxygenases

    • Molecular dynamics simulations of membrane integration

    • Docking studies with substrates and potential inhibitors

  • Functional Validation:

    • Structure-guided mutagenesis of catalytic residues

    • Chimeric enzyme construction to test domain functions

    • Correlation of structural features with kinetic parameters

  • Mechanistic Questions to Address:

    • How do the histidine-rich clusters coordinate metal ions?

    • What is the structural basis for sequential oxidation of the C-4 methyl group?

    • How does the enzyme interact with membrane-embedded sterol substrates?

    • What structural changes occur during the catalytic cycle?

Structural insights into ERG25 would significantly advance our understanding of sterol metabolism and potentially guide the development of selective inhibitors with applications in antifungal therapy .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.