Recombinant Saccharomyces cerevisiae Mitochondrial carrier protein MTM1 (MTM1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MTM1; YGR257C; G9175; Mitochondrial carrier protein MTM1; Manganese trafficking factor for mitochondrial SOD2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-366
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
Target Protein Sequence
MSDRNTSNSLTLKERMLSAGAGSVLTSLILTPMDVVRIRLQQQQMIPDCSCDGAAEVPNA VSSGSKMKTFTNVGGQNLNNAKIFWESACFQELHCKNSSLKFNGTLEAFTKIASVEGITS LWRGISLTLLMAIPANMVYFSGYEYIRDVSPIASTYPTLNPLFCGAIARVFAATSIAPLE LVKTKLQSIPRSSKSTKTWMMVKDLLNETRQEMKMVGPSRALFKGLEITLWRDVPFSAIY WSSYELCKERLWLDSTRFASKDANWVHFINSFASGCISGMIAAICTHPFDVGKTRWQISM MNNSDPKGGNRSRNMFKFLETIWRTEGLAALYTGLAARVIKIRPSCAIMISSYEISKKVF GNKLHQ
Uniprot No.

Target Background

Function
MTM1 is involved in the mitochondrial activation of SOD2 by specifically facilitating the insertion of the essential manganese cofactor. It also exhibits the ability to activate the iron regulon in an iron-dependent manner and responds to calorie restriction (CR) strength.
Gene References Into Functions
  1. The mitochondrial proteome of Deltamtm1 knockout yeast is depleted of pyridoxal 5'-phosphate. PMID: 25637770
  2. Transposon insertions in two genes were able to rescue the growth defect resulting from MTM1 deletion on nonfermentable carbon source. PMID: 20344951
Database Links

KEGG: sce:YGR257C

STRING: 4932.YGR257C

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of MTM1 in Saccharomyces cerevisiae?

MTM1 functions as a mitochondrial carrier protein that plays crucial roles in metal homeostasis and redox balance. Initially characterized as a manganese trafficking factor for mitochondrial superoxide dismutase 2 (SOD2), MTM1 facilitates the manganese activation of SOD2 specifically within the mitochondria . Recent research has expanded our understanding of MTM1 function to include roles in nickel homeostasis, iron distribution, and glutathione metabolism. The protein appears to be integral to maintaining proper mitochondrial function through its involvement in multiple metal trafficking pathways and antioxidant systems .

How is MTM1 localized within yeast cells?

MTM1 is specifically localized to the mitochondria in Saccharomyces cerevisiae. Fluorescence microscopy studies utilizing Mtm1-GFP fusion proteins have confirmed that MTM1 localization coincides with tubular structures identified by antibodies against mitochondrial porin protein . This mitochondrial localization is consistent with the human homologue of MTM1, CGI-69, which also localizes to mitochondria. The specific localization pattern supports MTM1's function in manganese trafficking and activation of mitochondrial SOD2, as opposed to cytosolic SOD enzymes .

What phenotypes are associated with MTM1 deletion in yeast?

MTM1 deletion in S. cerevisiae results in several distinct phenotypes:

  • Enhanced nickel tolerance compared to wild-type cells

  • Severely attenuated Superoxide dismutase 2 (Sod2p) activity

  • Hyperaccumulation of iron in both mitochondria and cytosol

  • Slight elevation of manganese in mitochondria, contrary to initial expectations

  • Accumulation of mitochondrial DNA mutations

  • Inability to use glycerol as a carbon source, a hallmark of mtDNA mutations

  • Altered glutathione distribution, with glutathione accumulating in the post-mitochondrial supernatant rather than in mitochondria

These phenotypes collectively point to MTM1's multifaceted role in metal homeostasis and mitochondrial redox balance.

How does MTM1 influence nickel homeostasis, and what methodologies are best for studying this interaction?

MTM1 plays a previously unrecognized role in nickel homeostasis, with MTM1 knockout cells displaying significantly higher nickel tolerance than wild-type cells. This phenotype appears to be mediated through changes in reactive oxygen species (ROS) levels .

Methodological approach: To study MTM1's role in nickel homeostasis, researchers should employ:

  • Metal sensitivity assays comparing growth of wild-type and mtm1Δ strains on media containing varying nickel concentrations

  • Metallomic methods including atomic absorption spectrometry to quantify mitochondrial and cytosolic nickel and iron levels

  • ROS detection assays using fluorescent probes to measure oxidative stress levels with and without nickel supplementation

  • Gene expression analysis to monitor SOD2 mRNA levels in response to nickel exposure

  • Enzyme activity assays to assess Sod2p function under different metal supplementation conditions

Research indicates that mtm1Δ cells show dramatically decreased mitochondrial accumulation of both nickel and iron compared to wild-type cells when exposed to excess nickel, suggesting a complex interplay between MTM1 and metal distribution between cellular compartments .

What is the relationship between MTM1, manganese trafficking, and SOD2 activity?

The relationship between MTM1, manganese, and SOD2 activity is complex and somewhat paradoxical. Initially, MTM1 was hypothesized to function as a mitochondrial manganese transporter, but experimental evidence has revealed a more nuanced role:

  • MTM1 deletion results in severely attenuated SOD2 activity, suggesting MTM1 is essential for SOD2 function .

  • Contrary to expectations, mtm1Δ mutants do not exhibit mitochondrial manganese deficiency; instead, they show slightly elevated mitochondrial manganese levels .

  • The SOD2 defect in mtm1Δ mutants can be restored by manganese supplementation, but only at toxic levels .

  • MTM1 appears to specifically facilitate manganese activation of mitochondrial SOD2, as cytosolic manganese SOD (SOD3) activity is unaffected by MTM1 deletion .

These findings suggest that MTM1's role extends beyond simple manganese transport, potentially involving proper metal presentation to SOD2 or prevention of mismetallation with other metals like iron. The methodological approach to studying this relationship should involve metal supplementation experiments, SOD activity assays, and careful subcellular fractionation to accurately measure metal distribution.

How does MTM1 influence mitochondrial iron accumulation and what are the implications for mitochondrial function?

MTM1 deletion results in dramatic iron accumulation in both mitochondria and cytosol . This iron hyperaccumulation phenomenon has significant implications for mitochondrial function:

Methodological considerations: Researchers investigating this phenomenon should employ:

  • Atomic absorption spectrometry to quantify mitochondrial and cytosolic iron levels

  • mtDNA mutation analysis to correlate iron levels with genetic damage

  • Respiratory competence assays (e.g., growth on glycerol media)

  • Cross-complementation studies with other iron homeostasis mutants

  • Transcriptional profiling to identify changes in expression of metal transporters

What are the optimal methods for isolating and analyzing mitochondria from mtm1Δ strains?

When isolating and analyzing mitochondria from mtm1Δ strains, researchers should consider several methodological approaches to ensure accurate assessment of metal content and protein activity:

  • Mitochondrial isolation techniques:

    • Differential centrifugation for crude mitochondrial preparation

    • Nycodenz gradient purification for highly purified mitochondria

    • Post-mitochondrial supernatant (PMS) should be retained for comparative analysis

  • Metal content analysis:

    • Atomic absorption spectrometry for quantifying manganese, iron, and nickel content

    • ICP-MS (Inductively Coupled Plasma Mass Spectrometry) for multi-element analysis

    • Subcellular fractionation to compare mitochondrial vs. cytosolic metal distribution

  • Protein activity assays:

    • In-gel activity assays for SOD2 function

    • Glutathione assays to measure GSH and GSSG levels in different cellular compartments

    • ROS detection methods to assess oxidative stress in isolated mitochondria

When comparing results between wild-type and mtm1Δ strains, it is critical to normalize measurements to consistent mitochondrial markers and to verify mitochondrial integrity during isolation procedures.

How should researchers design experiments to distinguish between direct and indirect effects of MTM1 deletion?

Distinguishing between direct and indirect effects of MTM1 deletion requires carefully designed experiments that address potential confounding factors:

  • Complementation studies:

    • Reintroduction of wild-type MTM1 to verify phenotype rescue

    • Domain-specific mutants to identify functional regions of MTM1

    • Heterologous expression of MTM1 homologs from other species

  • Temporal analysis:

    • Time-course experiments following MTM1 deletion or repression

    • Monitoring of early vs. late changes in metal distribution, protein activities, and gene expression

  • Separation of phenotypes:

    • Cross with rho⁻ strains (lacking mtDNA) to distinguish effects dependent on mtDNA mutations from direct MTM1 functions

    • Comparison with other mutants sharing individual phenotypes (e.g., iron accumulation mutants like isa1Δ)

  • Biochemical approaches:

    • In vitro reconstitution experiments with purified components

    • Direct metal binding assays with recombinant MTM1

    • Protein-protein interaction studies to identify MTM1's binding partners

These approaches can help determine which phenotypes are primary consequences of MTM1 loss versus secondary adaptations.

What expression systems and purification strategies are most effective for producing recombinant MTM1 for in vitro studies?

For successful production of recombinant MTM1 for in vitro studies, researchers should consider:

  • Expression systems:

    • E. coli systems with solubility-enhancing tags (MBP, SUMO, etc.)

    • Yeast expression systems (P. pastoris or S. cerevisiae) for proper folding

    • Insect cell expression for complex membrane proteins

    • Cell-free systems for potentially toxic proteins

  • Purification strategies:

    • Affinity chromatography using His-tag or other fusion tags

    • Ion exchange chromatography to separate different metal-bound forms

    • Size exclusion chromatography for final polishing

    • Detergent selection for maintaining structure of membrane-associated regions

  • Functional validation:

    • Metal content analysis of purified protein

    • Circular dichroism to verify proper folding

    • Activity assays to confirm functionality

    • Binding studies with potential substrates or interaction partners

  • Storage considerations:

    • Buffer optimization to maintain stability

    • Additive screening to prevent aggregation

    • Metal supplementation requirements

    • Freezing protocols to preserve activity

How do researchers reconcile the paradoxical increase in mitochondrial manganese in mtm1Δ strains despite decreased SOD2 activity?

One of the most intriguing paradoxes in MTM1 research is that mtm1Δ mutants exhibit decreased SOD2 activity despite slightly elevated mitochondrial manganese levels . Several hypotheses have been proposed to explain this apparent contradiction:

  • Metal misincorporation hypothesis:
    MTM1 may prevent mismetallation of SOD2 with incorrect metals like iron. In its absence, the wrong metal may be incorporated despite adequate manganese levels.

  • Manganese bioavailability hypothesis:
    Total manganese levels may be elevated, but the bioavailable pool accessible to SOD2 could be reduced. MTM1 might facilitate proper presentation of manganese to SOD2.

  • Compensatory response hypothesis:
    The elevated manganese might represent a secondary response to SOD2 inactivation, rather than a direct result of MTM1 loss.

  • Subcellular compartmentalization hypothesis:
    The manganese may accumulate in a different submitochondrial compartment than where SOD2 is active.

To investigate these possibilities, researchers should:

  • Measure metal content of immunoprecipitated SOD2 protein

  • Perform in vitro metal exchange experiments

  • Analyze submitochondrial fractions for metal distribution

  • Use metal-specific fluorescent probes to visualize bioavailable metal pools

What explains the differential effects of MTM1 deletion on mitochondrial SOD2 versus cytosolic SOD activity?

MTM1 deletion specifically affects mitochondrial SOD2 activity while leaving cytosolic manganese SOD (SOD3 from C. albicans expressed in S. cerevisiae) activity intact . This specificity provides important insights into MTM1's function:

SOD TypeLocalizationEffect of MTM1 DeletionManganese Requirement
SOD2 (S. cerevisiae)MitochondrialSeverely attenuated activityYes
SOD3 (C. albicans)Cytosolic when expressed in S. cerevisiaeNo effect on activityYes

This differential effect strongly suggests that MTM1's function is specific to the mitochondrial environment rather than affecting global manganese metabolism. Researchers investigating this phenomenon should:

  • Create chimeric SOD proteins with domains from both mitochondrial and cytosolic variants to identify critical regions responsible for MTM1 dependence

  • Determine if artificially targeting MTM1 to the cytosol affects cytosolic SOD activity

  • Assess whether mitochondrial targeting sequences on cytosolic SODs create MTM1 dependence

  • Examine whether other mitochondrial manganese-dependent enzymes also show reduced activity in mtm1Δ strains

How does the role of MTM1 in glutathione metabolism integrate with its functions in metal homeostasis?

Recent research suggests MTM1 plays a role in glutathione metabolism, with MTM1 deletion resulting in decreased mitochondrial glutathione (GSH) levels and accumulation in the post-mitochondrial supernatant . This finding adds another layer to MTM1's function:

  • Potential mechanisms:

    • MTM1 may directly transport glutathione into mitochondria

    • MTM1 might facilitate the activity of known glutathione transporters

    • Metal imbalances caused by MTM1 deletion could indirectly affect glutathione distribution

  • Integration with metal homeostasis:

    • Glutathione is a major cellular antioxidant and metal chelator

    • Changes in glutathione distribution could affect metal bioavailability

    • Both glutathione and SOD2 are part of mitochondrial antioxidant defenses

  • Methodological approaches:

    • Measure both reduced (GSH) and oxidized (GSSG) glutathione in different cellular compartments

    • Examine effects of exogenous glutathione on metal distribution in mtm1Δ strains

    • Investigate potential direct interactions between MTM1 and glutathione

    • Create double mutants affecting both MTM1 and known glutathione transporters

This emerging connection between MTM1, metal homeostasis, and glutathione metabolism highlights the complex interplay of mitochondrial redox systems and metal trafficking pathways.

What insights can yeast MTM1 research provide for understanding human MTM1-related disorders?

While yeast MTM1 and human MTM1 are not direct orthologs, research on the yeast protein can provide valuable insights into fundamental mechanisms of metal homeostasis and mitochondrial function relevant to human disorders:

  • Mechanistic insights:

    • Basic principles of metal trafficking and homeostasis are conserved across species

    • Understanding metal mismetallation mechanisms might inform treatment approaches for human metal-related disorders

    • Mitochondrial dysfunction is implicated in numerous human diseases

  • X-linked myotubular myopathy (MTM):

    • Human MTM1 mutations cause X-linked myotubular myopathy, a severe neuromuscular disease

    • Modeling human MTM1 p.R69C mutation in murine Mtm1 resulted in reduced muscle mass and force generation

    • Comparative studies between yeast and mammalian systems can highlight conserved and divergent pathways

  • Experimental approaches:

    • Humanized yeast models expressing human MTM1 variants

    • Comparative functional studies between yeast MTM1 and human homologs

    • Investigation of conserved interacting partners across species

Understanding the fundamental cellular functions of metal trafficking proteins in model organisms like yeast provides a foundation for developing therapeutic approaches for related human disorders.

How can MTM1 research inform the development of new approaches to study mitochondrial metal homeostasis disorders?

Research on MTM1 has revealed unexpected complexity in mitochondrial metal homeostasis, suggesting several approaches for studying related disorders:

  • Methodological innovations:

    • Combined metallomic and proteomic approaches to track metal-protein interactions

    • Development of metal-specific sensors for subcellular compartments

    • Genetic screening methods to identify suppressors of metal homeostasis defects

  • Conceptual advances:

    • Recognition that total metal levels may not reflect bioavailable pools

    • Understanding compensatory responses to metal trafficking defects

    • Appreciation for cross-talk between different metal homeostasis pathways

  • Therapeutic implications:

    • Targeted metal supplementation strategies

    • Approaches to modulate metal transporters or chaperones

    • Antioxidant interventions targeting specific subcellular compartments

MTM1 research demonstrates that interpreting metal homeostasis requires considering both metal abundance and bioavailability, compartmentalization, and the integration of multiple trafficking pathways—principles applicable to studying human mitochondrial disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.