Recombinant Saccharomyces cerevisiae Mitochondrial carrier protein RIM2 (RIM2)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes. We will do our best to accommodate your request.
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes. We will do our best to accommodate your request.
Lead Time
Delivery time may vary depending on your location and purchasing method. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. For dry ice shipping, please communicate with us in advance as additional fees will apply.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. For dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. We recommend storing working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we suggest centrifuging the vial briefly prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your own preparation.
Shelf Life
Shelf life is dependent on several factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize fulfilling your request.
Synonyms
RIM2; YBR192W; YBR1402; Mitochondrial carrier protein RIM2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-377
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
RIM2
Target Protein Sequence
MPKKSIEEWEEDAIESVPYLASDEKGSNYKEATQIPLNLKQSEIENHPTVKPWVHFVAGG
IGGMAGAVVTCPFDLVKTRLQSDIFLKAYKSQAVNISKGSTRPKSINYVIQAGTHFKETL
GIIGNVYKQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDMYAKAFNNGQETPMIHLM
AAATAGWATATATNPIWLIKTRVQLDKAGKTSVRQYKNSWDCLKSVIRNEGFTGLYKGLS
ASYLGSVEGILQWLLYEQMKRLIKERSIEKFGYQAEGTKSTSEKVKEWCQRSGSAGLAKF
VASIATYPHEVVRTRLRQTPKENGKRKYTGLVQSFKVIIKEEGLFSMYSGLTPHLMRTVP
NSIIMFGTWEIVIRLLS
Uniprot No.
Target Background
Gene References Into Functions
- In the absence of the primary iron transporters Mrs3 and Mrs4, Rim2 carrier can facilitate iron transport into the mitochondrial matrix in a pyrimidine-nucleotide-dependent manner. PMID: 23800229
- Rim2 functions as a pyrimidine exchanger with an additional unique role in promoting mitochondrial iron utilization. PMID: 21777202
- Rim2p has been identified as a yeast mitochondrial pyrimidine nucleotide transporter. PMID: 16194150
Database Links
KEGG: sce:YBR192W
STRING: 4932.YBR192W
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
