Recombinant Saccharomyces cerevisiae Mitochondrial chaperone BCS1 (BCS1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
BCS1; YDR375C; D9481.17; Mitochondrial chaperone BCS1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-456
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
BCS1
Target Protein Sequence
MSDKPIDIQYDKQATPNLSGVITPPTNETGNDSVREKLSKLVGDAMSNNPYFAAGGGLMI LGTGLAVARSGIIKASRVLYRQMIVDLEIQSKDKSYAWFLTWMAKHPQRVSRHLSVRTNY IQHDNGSVSTKFSLVPGPGNHWIRYKGAFILIKRERSAKMIDIANGSPFETVTLTTLYRD KHLFDDILNEAKDIALKTTEGKTVIYTSFGPEWRKFGQPKAKRMLPSVILDSGIKEGILD DVYDFMKNGKWYSDRGIPYRRGYLLYGPPGSGKTSFIQALAGELDYNICILNLSENNLTD DRLNHLMNNMPERSILLLEDIDAAFNKRSQTGEQGFHSSVTFSGLLNALDGVTSSEETIT FMTTNHPEKLDAAIMRPGRIDYKVFVGNATPYQVEKMFMKFYPGETDICKKFVNSVKELD ITVSTAQLQGLFVMNKDAPHDALKMVSSLRNANHIF
Uniprot No.

Target Background

Function
Essential for the expression of the Rieske iron-sulfur protein.
Gene References Into Functions
  1. The absence of non-essential translation factors Rrf1 or Mif3, involved in recycling/initiation steps, compensates for respiratory deficiencies in yeast *bcs1* mutants. PMID: 28888990
  2. The ATP dependence of Bcs1 is crucial not only for its chaperone activity but also for coupling complex III biogenesis to mitochondrial energy transduction. PMID: 24055101
  3. The conserved short alpha helix of Bcs1 in the intermembrane space is essential for its chaperone function. PMID: 24361883
  4. The oligomeric AAA-ATPase Bcs1 facilitates the export of Rip1's folded Fe-S domain across the inner membrane and insertion of its transmembrane segment into a cytochrome *bc1* complex assembly intermediate. PMID: 22017868
  5. Residues at the junction between the Bcs1p-specific and AAA domains are critical for protein activity and stability; residue F342 is particularly important for interactions with other proteins or substrates. PMID: 19285991
Database Links

KEGG: sce:YDR375C

STRING: 4932.YDR375C

Protein Families
AAA ATPase family, BCS1 subfamily
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is the primary function of BCS1 in Saccharomyces cerevisiae?

BCS1 in S. cerevisiae functions as a specialized chaperone protein essential for the biogenesis of the respiratory chain complex III (ubiquinol-cytochrome c reductase or bc1 complex). Its primary role is facilitating the transport and insertion of the Rieske iron-sulfur protein (Rip1) into the developing complex III structure within the inner mitochondrial membrane .

Methodologically, researchers investigating BCS1 function typically employ respiratory-deficient pet mutants and complementation assays. The function can be verified through:

  • Measurement of ubiquinol-cytochrome c reductase activity in wild-type versus bcs1 mutant strains

  • Immunoblot analysis to quantify levels of Rieske protein and other subunits of complex III

  • Transformation experiments with multicopy plasmids containing the iron-sulfur protein gene to assess whether overexpression can rescue the phenotype

These approaches have consistently demonstrated that even when Rieske protein levels are increased through genetic manipulation, the enzymatic defect persists in bcs1 mutants, confirming BCS1's specific role in proper assembly rather than simply protein production .

How is BCS1 localized within mitochondria?

BCS1 is localized to the mitochondria where it performs its essential functions in respiratory chain assembly. The protein contains specific targeting sequences that direct it to the mitochondrial compartment .

To study BCS1 localization, researchers typically employ:

  • Fluorescent protein tagging (e.g., GFP fusion constructs) for visualization by confocal microscopy

  • Co-localization studies with established mitochondrial markers

  • Subcellular fractionation followed by Western blotting

  • Immunogold electron microscopy for precise submitochondrial localization

For example, studies in Aspergillus fumigatus have demonstrated substantial colocalization of Bcs1A-GFP fusion protein fluorescence with mitochondrial markers, confirming its mitochondrial localization . This approach can be adapted for S. cerevisiae BCS1 studies using appropriate yeast expression vectors and imaging protocols.

What are the structural domains of BCS1 and their significance?

BCS1 contains several important structural domains that contribute to its function:

DomainPositionFunctionConservation
N-terminal transmembraneN-terminusMembrane anchoringPresent in most BCS1 homologs
BCS1_NFollowing transmembrane segmentTargeting and possibly regulationHighly conserved across eukaryotes
AAA ATPaseCentral regionATP binding and hydrolysisHighly conserved, contains Walker A/B motifs
C-terminal regionC-terminusSpecificity for substrate recognitionModerately conserved

Methodologically, domain function analysis requires:

  • Site-directed mutagenesis of key residues

  • Deletion analysis of specific domains

  • Complementation assays with mutated constructs

  • Protein-protein interaction studies to identify functional partners

The AAA domain contains several signature sequences commonly found in ATPases and nucleotide binding proteins, which are essential for the energy-dependent chaperone activity of BCS1 . Bioinformatic analyses show strong conservation of these domains from fungi to humans, underscoring their functional importance .

How does BCS1 differ from other mitochondrial chaperones?

BCS1 belongs to the AAA family of proteins but differs from other mitochondrial chaperones in several important ways:

Chaperone TypeSubstratesMechanismATP Dependence
BCS1Primarily Rieske Fe/S proteinMembrane insertionATP-dependent
HSP60/HSP10MultipleProtein foldingATP-dependent
HSP70 (mtHSP70)MultipleImport and foldingATP-dependent
ProhibitinsVarious membrane proteinsAssembly/stabilizationATP-independent

To differentiate BCS1 from other chaperones experimentally:

  • Compare substrate specificity using immunoprecipitation and mass spectrometry

  • Measure ATPase activity with different substrates

  • Perform competition assays with other chaperones

  • Analyze phenotypic consequences of mutations in different chaperone systems

Unlike general chaperones that assist in folding multiple proteins, BCS1 has evolved specialized functions for respiratory chain complex assembly, particularly for the incorporation of the Rieske iron-sulfur protein into complex III .

What experimental approaches are most effective for studying BCS1 function in yeast?

Investigating BCS1 function requires a multi-faceted experimental approach:

TechniqueApplicationAdvantagesLimitations
Gene deletion/knockdownPhenotypic analysisReveals essentiality and functional impactsMay be lethal or have pleiotropic effects
Conditional expressionTemporal control of BCS1Allows study of essential genesLeaky expression can complicate analysis
Site-directed mutagenesisStructure-function analysisPrecise targeting of functional domainsRequires knowledge of critical residues
Blue native PAGEComplex III assemblyVisualizes respiratory supercomplexesTechnical challenges in sample preparation
Respiratory assaysFunctional assessmentQuantifies physiological impactsIndirect measure of BCS1 function

When designing experiments to study BCS1:

  • Use respiratory-deficient (pet) mutants as a starting point for complementation studies

  • Employ both fermentable (glucose) and non-fermentable (glycerol, ethanol) carbon sources to detect respiratory defects

  • Implement immunological assays to quantify levels of the Rieske iron-sulfur protein and other complex III components

  • Utilize transformation with multicopy plasmids containing the iron-sulfur protein gene to test rescue capabilities

Notably, transformation of bcs1 mutants with the iron-sulfur protein gene on multicopy plasmids leads to elevated mitochondrial concentrations of Rieske protein but does not correct the enzymatic defect, indicating BCS1's role beyond simple protein production .

What is the relationship between BCS1 and antifungal drug resistance mechanisms?

Recent research has uncovered intriguing connections between BCS1 function and antifungal drug responses:

Drug ClassEffect of BCS1 DeletionMechanismModel Organism
AzolesIncreased resistanceUpregulation of efflux pumpsA. fumigatus
TerbinafineIncreased resistanceAltered mitochondrial functionA. fumigatus
SimvastatinIncreased resistanceMetabolic adaptationA. fumigatus

Methodologically, researchers investigating this relationship should:

  • Determine minimum inhibitory concentrations (MICs) for various antifungals in wild-type and bcs1 mutant strains

  • Perform RNA sequencing and RT-qPCR analysis to identify differentially expressed genes, particularly drug efflux pumps

  • Create double mutants lacking both BCS1 and key efflux pumps to determine epistatic relationships

  • Monitor changes in mitochondrial membrane potential and ROS production in response to drug treatment

Studies in A. fumigatus have demonstrated that deletion of bcs1A results in upregulation of multiple efflux pumps, contributing to increased resistance to azoles and other antifungals. Loss of the principal drug efflux pump, mdr1, decreased azole tolerance in the Δbcs1A mutant, suggesting that BCS1 modulates drug responses via regulation of efflux pump expression .

How does BCS1 contribute to mitochondrial respiratory chain assembly?

BCS1 plays a critical role in the assembly of respiratory chain complex III through several mechanisms:

StageBCS1 FunctionExperimental EvidenceConsequence of Disruption
Pre-assemblyFolding of Rieske Fe/S proteinAccumulation of precursors in mutantsDefective complex III
TransportTranslocation of folded Rieske proteinLocalization studiesRieske protein remains in matrix
AssemblyIncorporation into complex IIIBlue native PAGE analysisIncomplete complex III
StabilityMaintenance of complex integrityProtein turnover assaysAccelerated degradation

Advanced experimental approaches to study this process include:

  • Time-course radiolabeling and pulse-chase experiments to track assembly kinetics

  • Crosslinking studies to capture transient interactions during assembly

  • Cryo-electron microscopy to visualize structural intermediates

  • In vitro reconstitution assays with purified components

These methodologies have revealed that BCS1 functions as an ATP-dependent translocase, facilitating the transport and insertion of the folded Rieske Fe/S protein into the partially assembled complex III. Without BCS1 function, the Rieske protein accumulates in the mitochondrial matrix and fails to incorporate into complex III, resulting in respiratory deficiency .

What are the physiological consequences of BCS1 mutations or deficiency?

BCS1 deficiency leads to numerous physiological consequences that can be quantified and studied:

PhenotypeMeasurement MethodSeverity in Different ModelsClinical Relevance
Growth defectsGrowth curves, colony sizeSevere in yeast and filamentous fungiDevelopment disorders
Respiratory dysfunctionOxygen consumption, ATP levelsPronounced on non-fermentable carbon sourcesMetabolic diseases
ROS productionFluorescent probes, antioxidant enzyme assaysDecreased in A. fumigatusOxidative stress
Mitochondrial membrane potentialRhodamine 123, JC-1 stainingSignificantly reducedEnergy production
Ion homeostasisIon-selective electrodesDisrupted in mutantsCellular signaling

To study these consequences experimentally:

  • Compare growth rates on different carbon sources (glucose vs. glycerol/ethanol)

  • Measure mitochondrial membrane potential using flow cytometry with appropriate dyes

  • Quantify ROS production using fluorescent probes

  • Assess osmotic stress sensitivity using media supplemented with various stressors (KCl, NaCl, sorbitol)

Studies in A. fumigatus have shown that BCS1 deletion compromises colony growth and the utilization of non-fermentable carbon sources, while also causing abnormal mitochondrial membrane potential and reduced reactive oxygen species production . The BCS1-deficient mutants also display increased sensitivity to osmotic stress, highlighting BCS1's role in maintaining cellular homeostasis beyond its direct function in respiratory chain assembly .

How conserved is BCS1 across different species and what can we learn from comparative studies?

BCS1 demonstrates strong evolutionary conservation across eukaryotes:

SpeciesBCS1 HomologKey DomainsFunctional ConservationDisease Association
S. cerevisiaeBcs1AAA domain, BCS1_NOriginal modelGrowth defects
A. fumigatusBcs1AAAA domain, BCS1_NStrong functional similarityAntifungal resistance
H. sapiensBCS1LAAA domain, BCS1_NHigh conservationGRACILE syndrome, others
M. musculusBcs1lAAA domain, BCS1_NSimilar to humanModel for human diseases

Methodologically, comparative studies should:

  • Perform detailed sequence alignments and phylogenetic analyses to identify conserved regions

  • Express cross-species BCS1 homologs in model organisms to test functional complementation

  • Create chimeric proteins with domains from different species to map functional conservation

  • Use CRISPR-Cas9 to introduce equivalent mutations across species

Bioinformatic analyses have revealed that the two key domains (BCS1_N and AAA) are contained in all selected BCS1 homologs, suggesting strong conservation of BCS1 as a mitochondrial protein from fungi to humans . This conservation enables cross-species studies that can illuminate fundamental aspects of BCS1 function while also providing insights into species-specific adaptations.

What controls are essential when studying BCS1 in experimental systems?

Proper experimental controls are critical for BCS1 research:

Control TypePurposeImplementationImportance
Wild-type strainBaseline comparisonSame genetic backgroundEssential baseline
Complemented strainConfirm phenotype causalityRe-expression of BCS1Eliminates off-target effects
Empty vectorControl for vector effectsSame vector without BCS1Important for overexpression studies
Growth condition controlsCarbon source effectsFermentable vs. non-fermentableCritical for respiratory phenotypes
Negative controlsBackground signalNo-antibody, isotype controlsEssential for immunological methods

When designing BCS1 experiments:

  • Always include isogenic wild-type strains grown under identical conditions

  • Create complemented strains where the deleted BCS1 gene is reintroduced

  • Use multiple carbon sources to distinguish respiratory from non-respiratory phenotypes

  • Include appropriate controls for any tags or modifications introduced to BCS1

  • Implement double-blind scoring for subjective phenotypic assessments

Following these control principles ensures that observed phenotypes can be directly attributed to BCS1 function rather than secondary effects or experimental artifacts. For example, in studies of A. fumigatus, researchers included wild-type, mutant, and complemented strains when assessing growth phenotypes and drug responses .

How can recombinant BCS1 be effectively expressed and purified for biochemical studies?

Expression and purification of recombinant BCS1 presents unique challenges due to its membrane association and complex structure:

Expression SystemAdvantagesDisadvantagesYield
E. coliRapid growth, high yieldLack of eukaryotic modificationsLow-moderate
YeastNative environment, proper foldingSlower growth than bacteriaModerate
Insect cellsEukaryotic modificationsMore complex systemModerate-high
Mammalian cellsFull post-translational modificationsExpensive, low yieldLow

Recommended purification protocol:

  • Express BCS1 with an affinity tag (His6, GST, or FLAG) at either N- or C-terminus

  • Solubilize membranes using gentle detergents (DDM, LMNG, or digitonin)

  • Perform affinity chromatography under conditions that maintain protein-lipid interactions

  • Apply size exclusion chromatography to obtain homogeneous protein preparations

  • Verify protein activity through ATPase assays and substrate binding experiments

Critical considerations include:

  • Testing both N- and C-terminal tags, as accessibility may vary

  • Optimizing detergent concentration to solubilize BCS1 without denaturing it

  • Including ATP or non-hydrolyzable analogs during purification to stabilize the protein

  • Maintaining physiological pH and ionic strength throughout purification

These approaches have been successfully applied to AAA proteins similar to BCS1 and can be adapted for biochemical studies of the recombinant S. cerevisiae BCS1 protein.

What are the best methods for assessing BCS1's role in complex III assembly?

Several complementary approaches can effectively assess BCS1's role in complex III assembly:

MethodInformation ProvidedAdvantagesTechnical Considerations
Blue native PAGENative complex integrityPreserves supercomplexesDetergent selection critical
Complex III activity assaysFunctional outputDirect measure of functionMultiple control conditions needed
ImmunoprecipitationProtein-protein interactionsIdentifies assembly partnersAntibody specificity important
Import assaysPrecursor processingDirectly measures importRequires isolated mitochondria
Protease protectionSubmitochondrial localizationMaps protein topologyNeeds carefully titrated conditions

Experimental workflow:

  • Isolate intact mitochondria from wild-type and bcs1 mutant strains

  • Solubilize mitochondrial membranes with mild detergents (digitonin preferred)

  • Separate protein complexes by blue native PAGE

  • Perform in-gel activity assays or transfer to membranes for immunoblotting

  • Quantify complex III assembly intermediates and subunit incorporation

This approach directly visualizes the defects in complex III assembly resulting from BCS1 dysfunction. Studies have shown that in bcs1 mutants, there is accumulation of a partially assembled complex III lacking the Rieske iron-sulfur protein, confirming BCS1's specific role in incorporating this subunit .

How can researchers effectively study interactions between BCS1 and the Rieske iron-sulfur protein?

Investigating the critical interaction between BCS1 and its substrate, the Rieske iron-sulfur protein, requires specialized approaches:

TechniqueApplicationAdvantagesLimitations
CrosslinkingCapture transient interactionsWorks in vivoMay capture non-specific interactions
Co-immunoprecipitationPhysical associationRelatively straightforwardMay miss weak interactions
FRET/BRETReal-time interaction dynamicsWorks in living cellsRequires protein tagging
Surface plasmon resonanceBinding kineticsQuantitativeRequires purified components
Hydrogen-deuterium exchangeInteraction interfacesHigh resolutionComplex data analysis

Experimental strategy:

  • Create tagged versions of BCS1 and Rieske protein that maintain function

  • Perform reciprocal co-immunoprecipitation experiments with and without crosslinking

  • Use ATP and non-hydrolyzable analogs to capture different states of the interaction

  • Map interaction domains through truncation and point mutation analysis

  • Validate interactions in vivo using proximity ligation assays or split-GFP approaches

These methods can reveal not only if an interaction occurs but also its ATP dependence, the specific domains involved, and how mutations affect the interaction. Research has demonstrated that BCS1 transiently interacts with the Rieske protein during its integration into complex III in an ATP-dependent manner .

How can researchers address common challenges in BCS1 experimental studies?

BCS1 research presents specific challenges that require careful troubleshooting:

ChallengePossible CausesSolutionsPreventive Measures
Poor growth of mutantsEssential functionUse conditional allelesMaintain on fermentable media
Low protein expressionToxicity, degradationOptimize expression conditionsUse inducible promoters
Protein aggregationImproper foldingScreen detergents, add stabilizersInclude ATP during purification
Complex phenotypesPleiotropic effectsUse specific functional assaysCreate point mutations
Variable resultsGrowth conditionsStandardize media and conditionsInclude multiple controls

Methodological recommendations:

  • For severely growth-deficient strains, use tetracycline-repressible or glucose-repressible promoters

  • When purifying BCS1, screen a panel of detergents (DDM, LMNG, digitonin) at various concentrations

  • Include ATP or non-hydrolyzable analogs in buffers to stabilize protein conformation

  • For inconsistent phenotypes, strictly control temperature, pH, and growth phase

  • When possible, quantify multiple parameters (growth, complex assembly, respiration) to build convergent evidence

These approaches can help overcome the inherent challenges of studying an essential protein involved in complex assembly processes. For example, researchers studying BCS1 homologs in A. fumigatus successfully used conditional expression systems to overcome the severe growth defects of complete deletion mutants .

What contradictory findings exist in BCS1 research and how might they be resolved?

Several areas of BCS1 research have yielded seemingly contradictory findings:

Controversial AreaConflicting ObservationsPossible ExplanationsResolution Approaches
Role in drug resistanceBoth increased and decreased resistanceContext-dependent effectsStandardize drug testing methods
ROS productionIncreased vs. decreasedStrain backgrounds, growth conditionsNormalize to mitochondrial content
ATP requirementStrict vs. partial dependenceExperimental conditionsStructure-function studies
Interactions with complex III subunitsDirect vs. indirectDetection sensitivityMultiple interaction methods

To resolve these contradictions:

  • Directly compare strains using identical experimental conditions

  • Perform systematic structure-function analyses with targeted mutations

  • Use multiple complementary techniques to assess each phenotype

  • Consider genetic background effects by testing in different strain contexts

  • Examine temporal aspects, as phenotypes may change over time or growth phases

For example, contradictory findings regarding drug resistance could be resolved by standardizing drug exposure protocols and quantifying both immediate and adaptive responses. The observation that BCS1 deletion can lead to decreased ROS production in A. fumigatus but increased ROS in other contexts might be explained by differences in metabolism or compensatory mechanisms.

How can researchers validate that their recombinant BCS1 retains native functionality?

Validating the functionality of recombinant BCS1 is essential for meaningful biochemical studies:

Validation ApproachWhat It TestsImplementationSuccess Criteria
Complementation assaysIn vivo functionTransform mutant strainsRescue of growth defects
ATPase activityEnzymatic functionIn vitro ATP hydrolysisKinetic parameters similar to native
Substrate bindingInteraction capacityPull-down or SPR with Rieske proteinSpecific, saturable binding
Oligomerization stateStructural integritySize exclusion, analytical ultracentrifugationFormation of proper oligomers
Thermal stabilityProper foldingThermal shift assaysMelting curve similar to native

Comprehensive validation protocol:

  • Express recombinant BCS1 in a bcs1-null background and test for phenotypic rescue

  • Purify the protein and verify its oligomeric state by size exclusion chromatography

  • Measure ATP hydrolysis activity and compare to native BCS1 activity

  • Test binding to the Rieske iron-sulfur protein and other established partners

  • Assess thermal stability with and without ATP to verify proper folding

These validation steps ensure that any results obtained with recombinant BCS1 actually reflect the protein's native functions rather than artifacts of the recombinant system. This is particularly important for mechanistic studies that aim to understand how BCS1 facilitates complex III assembly.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.