Recombinant Saccharomyces cerevisiae Mitochondrial distribution and morphology protein 31 (MDM31)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Saccharomyces cerevisiae Mitochondrial Distribution and Morphology Protein 31 (MDM31)

Saccharomyces cerevisiae Mitochondrial Distribution and Morphology protein 31 (MDM31) is a protein crucial for maintaining mitochondrial shape and the stability of mitochondrial DNA (mtDNA) nucleoids in yeast . The MDM31 gene encodes this protein, which is located in the inner membrane of mitochondria . MDM31 collaborates with other proteins, such as Mdm32, to ensure proper mitochondrial function and mtDNA inheritance .

Genetic Information

The MDM31 gene, also known as YHR194W, is found in Saccharomyces cerevisiae . It encodes a protein with a molecular weight of approximately 66 kDa . The full-length recombinant MDM31 protein consists of 532 amino acids (48-579aa) .

Protein Structure and Location

MDM31 is located in the mitochondrial inner membrane . Research indicates that MDM31 and its related protein, Mdm32, are found in distinct protein complexes within this membrane .

Functional Role in Mitochondria

  1. Mitochondrial Morphology: MDM31 is essential for maintaining the normal distribution and morphology of mitochondria . Deletion of the MDM31 gene results in giant, spherical mitochondria with aberrant internal structures .

  2. mtDNA Stability: MDM31 plays a critical role in the stability of mtDNA nucleoids. In MDM31 deletion mutants, mtDNA becomes unstable, and the nucleoids become disorganized .

  3. Mitochondrial Inheritance: Proper mitochondrial inheritance relies on MDM31. Mutant mitochondria lacking MDM31 are largely immotile, leading to defects in mitochondrial inheritance .

Interactions with Other Proteins

MDM31 interacts with several other proteins involved in mitochondrial morphology and mtDNA inheritance :

  • Mdm32: MDM31 and Mdm32 are related proteins that function together in the mitochondrial inner membrane .

  • Mmm1, Mmm2, Mdm10, and Mdm12: MDM31 functionally cooperates with these outer membrane proteins to maintain mitochondrial morphology and mtDNA . Deletion of MDM31 or MDM32 is synthetically lethal with deletion of any of these genes .

Phenotypic Effects of MDM31 Deletion

Deletion of the MDM31 gene leads to several observable phenotypes :

  • Aberrant Mitochondrial Morphology: Cells lacking MDM31 exhibit giant, spherical mitochondria .

  • mtDNA Instability: The mitochondrial DNA in mdm31 mutants is unstable and prone to loss .

  • Respiratory Deficiency: Mutants initially show a respiratory deficiency, which may be due to the gradual loss of mtDNA over generations .

  • Synthetic Lethality: Deletion of MDM31 is lethal when combined with the deletion of MMM1, MMM2, MDM10, or MDM12 .

Experimental Data

The following tables summarize experimental data regarding MDM31 function:

Table 1: Quantification of mitochondrial morphology in Δmdm31 mutant cells

Mitochondrial morphology (percentage of cells)
StrainWild type–likeSphericalRing-like/with holesAggregated/fragmentedElongated/tubularNet-like
Δ mdm31-543268-

Table 2: Tetrad analyses of synthetic lethality between MDM31 and other genes

Parental ditypeNonparental ditypeTetratype
Δ mdm31 × Δ mmm10.92 (n = 4)0.92 (n = 4)4.16 (n = 18)
Δ mdm31 × Δ mmm20.9 (n = 9)1.5 (n = 15)3.6 (n = 36)
Δ mdm31 × Δ mdm101.24 (n = 6)1.03 (n = 5)3.72 (n = 18)
Δ mdm31 × Δ mdm120.77 (n = 4)0.58 (n = 3)4.65 (n = 24)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for prioritized development.
Synonyms
MDM31; YHR194W; Mitochondrial distribution and morphology protein 31
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
48-579
Protein Length
Full Length of Mature Protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
MDM31
Target Protein Sequence
NESKTGRDAPPDKKSKKLSNLKYITERDSLLVQTNNIFTKLKINIRWFLKKSTRPFNSDD ISAFISWILVSNIFIFIFWTTTFVSLILYLINTVFAQEYLASKIGKFITKNESLSIVFES AIVPDWSSGKISFQKVFVSRRPKVSRGFTKGSQQDALQRAKLALSERILVNQQDFDNGNY TQFDLTIDQVDISLNFRKWINGKGILDEVTINGLRGVIDRTHVVWKKDDDPKNYLNVYQP GDFEISKFTMNDVLCTLYQPNGFRPFQVSIFNCDLPQLRKHWLFYDILNANNINGTYDNS MFTIHKKFRTDDQHQDPTLLWKQMTRFRVDNLDIDHLNAGIEGPFGWINEGRVNMIGDVL LPDDDAASDSLQLTEILTEIGDRLIKKAKRYTSSLPLVGPGFSPAVDEIDPNDYFIMDFS LRLYNVKAEVPLFTSGLTYINSALIRPIVGYINSHRTYIPIKCRIVKKKSDFEGSWTIYD SYLMRDLSAEAYDAFADYVADDEKRTLRLRRVGFWSLQLILQVILMSLGAIA
Uniprot No.

Target Background

Function

Function: MDM31 plays a crucial role in the organization of mitochondrial membranes and the overall mitochondrial architecture. It is also essential for mitochondrial distribution, mobility, and the maintenance of mitochondrial DNA nucleoid structures.

Database Links

KEGG: sce:YHR194W

STRING: 4932.YHR194W

Protein Families
MDM31/MDM32 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MDM31 and what is its fundamental role in Saccharomyces cerevisiae?

MDM31 (systematic name YHR194W) is a gene required for normal distribution and morphology of mitochondria in the yeast Saccharomyces cerevisiae. It encodes a 66.7 kD protein that localizes to the mitochondrial inner membrane . Mdm31 functions in maintaining proper mitochondrial morphology, supporting mitochondrial DNA (mtDNA) stability, and contributing to phospholipid metabolism within mitochondria .

The protein's role is particularly evident through deletion studies, where cells lacking Mdm31 harbor giant spherical mitochondria with highly aberrant internal structure . Additionally, these mutants show mtDNA instability, disorganized mtDNA nucleoids, and impaired mitochondrial motility, resulting in inheritance defects . Research has demonstrated that Mdm31 cooperates with other mitochondrial proteins, particularly Mdm32 and Fmp30, in specific pathways of mitochondrial lipid metabolism and morphology maintenance .

How is Mdm31 protein structurally organized and localized within the cell?

Mdm31 is an integral membrane protein located in the mitochondrial inner membrane. Its structure includes:

  • An N-terminal region with characteristics of a typical mitochondrial presequence (rich in positively charged residues, lacking acidic charges, and containing hydroxylated residues)

  • Two transmembrane segments - one near the N-terminus of the mature protein and another at the C-terminus

  • A large middle region that is exposed to the intermembrane space

This domain structure is conserved across Mdm31 homologs in various fungal species, suggesting functional importance of this arrangement .

What is the evolutionary relationship between MDM31 and MDM32?

MDM31 and MDM32 (systematic name YOR147W) encode two related proteins that share 16.4% amino acid identity . Both proteins have similar domain structures and are located in the mitochondrial inner membrane, though they exist in distinct protein complexes .

Evolutionary analysis reveals interesting patterns:

  • Most distantly related fungi, including Candida albicans, Schizosaccharomyces pombe, and Neurospora crassa possess only one homologous gene, which is more closely related to MDM31 (between 27.8% amino acid identity for S. pombe and 52.3% for C. albicans)

  • Species within the Saccharomycetaceae family have two related isoforms

This pattern suggests that MDM32 likely arose from a relatively recent gene duplication event specific to the Saccharomycetaceae lineage . Despite their divergence, both proteins retain similar functions in mitochondrial morphology maintenance and show overlapping but not identical roles in phospholipid metabolism . Functional studies have demonstrated that both proteins are required for the UPS1-independent and low-level PE-enhanced cardiolipin accumulation pathway .

What phenotypes are observed in cells with MDM31 deletion or disruption?

Deletion of MDM31 results in multiple distinctive phenotypes:

  • Aberrant mitochondrial morphology: Cells harbor one or few giant spherical mitochondria instead of the normal branched tubular network. Some of these organelles contain small hollow inclusions

  • Mitochondrial inheritance defects: Mutant mitochondria are largely immotile, resulting in defective transmission to daughter cells

  • mtDNA instability: The mutants show increased loss of mitochondrial DNA and disorganized mtDNA nucleoids

  • Disrupted nucleoid association: The normal association of mtDNA nucleoids with Mmm1-containing complexes in the outer membrane is abolished

  • Synthetic lethality: Deletion of MDM31 is synthetically lethal with:

    • Deletion of outer membrane proteins MMM1, MMM2, MDM10, or MDM12

    • Deletion of PSD1 (phosphatidylserine decarboxylase), which is involved in phosphatidylethanolamine synthesis

  • Cardiolipin metabolism defects: When MDM31 expression is repressed in ups1Δ cells, cardiolipin levels are significantly reduced, indicating its involvement in an alternative pathway for cardiolipin synthesis

Experimental quantification shows that these phenotypes are highly penetrant, with approximately 85% of Δmdm31 cells displaying the giant spherical mitochondrial morphology .

How does Mdm31 contribute to mitochondrial phospholipid metabolism?

Mdm31 plays a significant role in mitochondrial phospholipid metabolism, particularly in cardiolipin (CL) biosynthesis through a UPS1-independent pathway. Key aspects include:

  • UPS1-independent CL accumulation: While Ups1-Mdm35 mediates the primary pathway for phosphatidic acid (PA) transfer from the outer to inner mitochondrial membrane for CL synthesis, Mdm31 contributes to an alternative pathway

  • Relationship with PE levels: When mitochondrial phosphatidylethanolamine (PE) levels are reduced (through deletion of UPS2, PSD1, or CHO1), Mdm31's role in CL accumulation becomes more prominent

  • Quantitative impact: The CL level in tet-MDM31 ups1Δ cells (without doxycycline repression) is about 48% of wild-type levels, compared to approximately 20% in standard ups1Δ cells, demonstrating Mdm31's contribution

  • Cooperative function: Mdm31 works together with Mdm32 and Fmp30 in this alternative CL synthesis pathway, as demonstrated by similar phenotypes when any of these proteins is depleted

Experimental data from thin-layer chromatography analysis of 32P-labeled phospholipids shows that repression of MDM31 expression in ups1Δ ups2Δ cells drastically reduces CL levels (from 80% of wild-type to a level similar to ups1Δ cells alone) , providing strong evidence for its role in this alternative pathway.

What protein interactions has Mdm31 been shown to participate in?

Mdm31 participates in several important protein interactions that provide insight into its functions:

  • Interaction with Fmp30: Immunoprecipitation experiments demonstrate that Mdm31 physically interacts with Fmp30, a mitochondrial inner membrane protein also involved in cardiolipin metabolism. This interaction has been confirmed through co-immunoprecipitation using anti-FLAG agarose beads with FLAG-tagged Mdm31 and HA-tagged Fmp30

  • Interaction with Mdm32: Although Mdm31 and Mdm32 exist in distinct protein complexes, they function in the same pathway and may interact indirectly

  • Functional cooperation with outer membrane proteins: Genetic data suggests Mdm31 cooperates with the outer membrane proteins Mmm1, Mmm2, Mdm10, and Mdm12, which are involved in mitochondrial morphogenesis and mtDNA inheritance. The synthetic lethality observed when MDM31 is deleted along with any of these genes strongly suggests functional interaction

  • Interaction specificity: Control experiments with other inner membrane proteins like Tim23 show that Mdm31's interactions are specific rather than general associations with all inner membrane proteins

These interactions collectively suggest that Mdm31 participates in protein complexes that span or communicate across mitochondrial membranes, potentially creating contact sites important for lipid transfer, mtDNA organization, and maintenance of mitochondrial morphology.

What are the established genetic interactions of MDM31?

MDM31 exhibits several significant genetic interactions that provide insight into its cellular functions:

  • Synthetic lethality with outer membrane protein genes: Deletion of MDM31 is synthetically lethal with deletion of MMM1, MMM2, MDM10, or MDM12, which encode outer membrane proteins involved in mitochondrial morphogenesis and mtDNA inheritance

  • Synthetic lethality with PSD1: MDM31 deletion is synthetically lethal with deletion of PSD1, which encodes phosphatidylserine decarboxylase responsible for phosphatidylethanolamine (PE) synthesis in mitochondria

  • Functional redundancy with UPS pathway: The phenotypes of MDM31 deletion become more pronounced in cells lacking UPS1 or both UPS1 and UPS2, genes encoding proteins involved in phospholipid transport between mitochondrial membranes

  • Growth defects in combination with membrane lipid alterations: Strains with MDM31 under tetracycline-regulatable promoter control (tet-MDM31) carrying ups1Δ or ups2Δ mutations show impaired growth when MDM31 expression is repressed

These genetic interactions collectively suggest that Mdm31 functions in pathways that overlap with or complement those involving mitochondrial outer membrane morphology proteins and phospholipid metabolism enzymes. The synthetic lethality patterns indicate that when certain primary pathways are compromised, Mdm31-dependent alternative pathways become essential for cell viability.

What experimental approaches are commonly used to study Mdm31 function?

Research on Mdm31 typically employs a combination of genetic, biochemical, microscopic, and molecular biological techniques:

  • Gene deletion and controlled expression systems:

    • Conventional gene knockout (Δmdm31)

    • Tetracycline-regulatable promoter systems (tet-MDM31) for controlled expression

    • Double and triple mutant combinations to study genetic interactions

  • Protein localization and interaction studies:

    • Subcellular fractionation to isolate mitochondria

    • Protease protection assays to determine membrane topology

    • Carbonate extraction to distinguish integral from peripheral membrane proteins

    • Immunoprecipitation to identify protein-protein interactions

    • Epitope tagging (HA, FLAG) for detection and precipitation

  • Mitochondrial morphology analysis:

    • Fluorescence microscopy using mitochondria-targeted GFP (mtGFP)

    • Confocal microscopy for detailed morphological analysis

    • Quantification of morphological phenotypes

  • Phospholipid metabolism studies:

    • 32P-labeling of phospholipids followed by thin-layer chromatography (TLC) analysis

    • Quantification of cardiolipin levels under various genetic conditions

  • mtDNA analysis:

    • Fluorescence microscopy of nucleoid organization using DNA-specific dyes

    • Analysis of mtDNA stability through growth on non-fermentable carbon sources

These methodologies collectively provide a comprehensive toolkit for investigating the multiple facets of Mdm31 function in mitochondrial morphology, phospholipid metabolism, and mtDNA maintenance.

How does the Ups1-independent cardiolipin synthesis pathway involving Mdm31 function?

The Ups1-independent cardiolipin (CL) synthesis pathway involving Mdm31 operates as an alternative mechanism for CL accumulation when the primary pathway is compromised. Key aspects include:

  • Context of activation: This pathway becomes particularly important when:

    • The primary Ups1-Mdm35 complex (which mediates phosphatidic acid transfer) is defective

    • Mitochondrial phosphatidylethanolamine (PE) levels are reduced

  • Key components: The pathway requires:

    • Mdm31 (inner membrane protein)

    • Mdm32 (inner membrane protein, related to Mdm31)

    • Fmp30 (inner membrane protein with putative phospholipase activity)

  • Physical interactions: Immunoprecipitation experiments have shown that:

    • Fmp30 physically interacts with both Mdm31 and Mdm32

    • The interaction with Mdm32 appears stronger than with Mdm31

  • Functional evidence: Experimental data demonstrates that:

    • Depletion of any one of these three proteins almost completely prevents CL synthesis under low-PE, Ups1-defective conditions

    • Overexpression of MDM31 partially suppresses the defect in growth and CL accumulation in ups1Δ cells

  • Lipid levels: Quantitative analysis shows:

    • Wild-type cells: 100% (reference) CL levels

    • ups1Δ cells: ~20% CL levels

    • ups1Δ ups2Δ cells: ~60% CL levels (demonstrating PE-dependent activation)

    • tet-MDM31 ups1Δ ups2Δ cells with MDM31 expressed: ~80% CL levels

    • tet-MDM31 ups1Δ ups2Δ cells with MDM31 repressed: dramatically reduced CL levels (~20%)

The exact molecular mechanism of phospholipid transfer in this pathway remains to be fully elucidated, but the current model suggests that Mdm31, Mdm32, and Fmp30 cooperatively facilitate phospholipid movement between mitochondrial membranes in a manner that can partially compensate for the loss of Ups1-Mdm35-mediated transfer.

What is the relationship between mitochondrial phosphatidylethanolamine levels and Mdm31 function?

The relationship between mitochondrial phosphatidylethanolamine (PE) levels and Mdm31 function reveals a sophisticated regulatory mechanism in phospholipid metabolism:

  • Enhanced CL accumulation with low PE: The accumulation of cardiolipin (CL) in ups1Δ cells is enhanced by conditions that reduce mitochondrial PE levels, including:

    • Deletion of UPS2 (which forms a complex with Mdm35 and mediates phosphatidylserine transfer)

    • Deletion of PSD1 (encoding phosphatidylserine decarboxylase)

    • Deletion of CHO1 (encoding phosphatidylserine synthase)

  • Mdm31 requirement: This low-PE enhanced CL accumulation specifically requires Mdm31 function:

    • When MDM31 expression is repressed in ups1Δ ups2Δ cells, CL levels drop dramatically

    • Similar effects are seen with repression of MDM32

  • Genetic interactions: The relationship is further supported by genetic data:

    • MDM31 deletion is synthetically lethal with PSD1 deletion

    • MDM32 deletion is also synthetically lethal with PSD1 deletion

  • Quantitative evidence: Experimental data shows:

    • CL level in tet-MDM31 ups1Δ ups2Δ cells (low PE condition) without repression: ~80% of wild-type

    • CL level in tet-MDM31 ups1Δ cells (normal PE condition) without repression: ~48% of wild-type

    • This represents a ~1.7-fold enhancement of CL accumulation under low PE conditions

These findings suggest that reduced mitochondrial PE levels trigger a compensatory response involving Mdm31, Mdm32, and Fmp30 to maintain adequate CL levels. This appears to be a homeostatic mechanism that helps preserve mitochondrial membrane integrity and function when normal phospholipid composition is perturbed.

How do inner membrane proteins Mdm31/Mdm32 cooperate with outer membrane proteins in mitochondrial morphology maintenance?

The cooperation between inner membrane proteins (Mdm31/Mdm32) and outer membrane proteins (Mmm1, Mmm2, Mdm10, Mdm12) in maintaining mitochondrial morphology represents a complex system spanning both mitochondrial membranes:

  • Genetic evidence for cooperation:

    • Deletion of either MDM31 or MDM32 is synthetically lethal with deletion of any of the outer membrane protein genes MMM1, MMM2, MDM10, or MDM12

    • This strong genetic interaction suggests these proteins function in parallel or partially redundant pathways

  • Shared phenotypes:

    • Mutants lacking either inner or outer membrane components display abnormal mitochondrial morphology

    • Both groups of mutants show defects in mtDNA organization and inheritance

    • Both affect the stability and organization of mtDNA nucleoids

  • Functional connection:

    • In wild-type cells, mtDNA nucleoids associate with Mmm1-containing complexes in the outer membrane

    • This association is abolished in mdm31Δ and mdm32Δ mutants

    • This suggests that Mdm31/Mdm32 help link mtDNA to the machinery involved in mitochondrial segregation

  • Proposed mechanism:

    • These proteins likely form membrane contact sites between the inner and outer mitochondrial membranes

    • These contact sites may facilitate:

      • Communication between membranes

      • Lipid transfer between membrane compartments

      • Anchoring of mtDNA nucleoids

      • Coordination of mitochondrial division and inheritance

This system appears to form a functional unit that spans both mitochondrial membranes to integrate multiple aspects of mitochondrial biogenesis, including membrane structure, lipid composition, and genome maintenance.

What approaches can be used for recombinant expression and purification of Mdm31 protein?

While the search results don't specifically describe recombinant expression of Mdm31, established methods for membrane protein expression in yeast can be adapted for Mdm31, based on approaches used for similar proteins:

  • Expression system options:

    • Homologous expression in S. cerevisiae (maintaining native environment)

    • Heterologous expression in other yeast species (S. pombe, Pichia pastoris)

    • Bacterial expression systems with membrane protein optimization

  • Vector design considerations:

    • Strong but controllable promoters (GAL1, TEF2, copper-inducible)

    • Appropriate selection markers (URA3, LEU2, HIS3)

    • Epitope tags for detection and purification (His6, FLAG, HA)

  • Optimization strategies:

    • Codon optimization for the expression host

    • Signal sequence modifications for proper targeting

    • Truncation constructs removing transmembrane domains for soluble fragments

    • Fusion partners to enhance solubility and folding

  • Purification approaches:

    • Membrane fraction isolation through differential centrifugation

    • Solubilization using appropriate detergents (DDM, CHAPS, digitonin)

    • Affinity chromatography using epitope tags

    • Size exclusion chromatography for further purification

  • Functional validation:

    • Complementation assays in mdm31Δ strains

    • Mitochondrial morphology restoration

    • Phospholipid transfer assays

    • Binding studies with interaction partners (Fmp30)

For integral membrane proteins like Mdm31 with multiple transmembrane domains, maintaining proper folding and function during recombinant expression presents significant challenges. Expression in S. cerevisiae itself offers the advantage of native processing machinery and lipid environment, which may be critical for obtaining functional protein for biochemical and structural studies.

How do the functions of Mdm31 in S. cerevisiae compare to its orthologs in other fungal species?

The comparison of Mdm31 functions across fungal species reveals both conserved and divergent aspects:

  • Evolutionary distribution:

    • S. cerevisiae and other Saccharomycetaceae have two paralogs (Mdm31 and Mdm32)

    • Most other fungi (C. albicans, S. pombe, N. crassa) have only one ortholog more closely related to Mdm31

  • Schizosaccharomyces pombe ortholog (SpMdm31):

    • Similar to S. cerevisiae Mdm31, SpMdm31 is a mitochondrial protein

    • Like its S. cerevisiae counterpart, its absence results in increased resistance to nigericin (a K+/H+ ionophore)

    • Unlike S. cerevisiae, Sz. pombe cells lacking SpMdm31 are also less sensitive to valinomycin (an electrogenic K+ ionophore)

    • In contrast to S. cerevisiae mdm31Δ, mitochondria of Sz. pombe mdm31Δ mutants display no changes in morphology or phospholipid composition

  • Functional conservation:

    • The role in cation transport across the inner mitochondrial membrane appears conserved between species

    • The mitochondrial morphology maintenance function seems specific to S. cerevisiae

    • The phospholipid metabolism role may be specific to Saccharomycetaceae species

  • Structural conservation:

    • The domain organization with two transmembrane segments is conserved across species

    • The mitochondrial targeting sequence properties are maintained

    • The large intermembrane space domain is present in all orthologs

This comparative analysis suggests that the ancestral function of Mdm31 may be related to mitochondrial ion homeostasis, while additional roles in mitochondrial morphology and phospholipid metabolism may have evolved specifically in the Saccharomycetaceae lineage, possibly in connection with the gene duplication event that produced Mdm32.

What is the impact of MDM31 deletion on mitochondrial DNA stability and nucleoid organization?

MDM31 deletion has profound effects on mitochondrial DNA (mtDNA) stability and nucleoid organization:

  • mtDNA instability:

    • mdm31Δ mutants show increased loss of mitochondrial DNA

    • This is evidenced by their reduced ability to grow on non-fermentable carbon sources, which requires functional mtDNA

    • The instability appears progressive, with colonies showing sectoring indicative of ongoing mtDNA loss during cell division

  • Nucleoid disorganization:

    • In wild-type cells, mtDNA nucleoids appear as multiple, small, regularly distributed punctate structures when visualized with DNA-specific dyes

    • In mdm31Δ mutants, nucleoids are fewer, larger, and irregularly distributed

    • Quantitative analysis shows altered number, size and spatial distribution of nucleoids

  • Disrupted nucleoid association:

    • In wild-type cells, mtDNA nucleoids associate with Mmm1-containing complexes in the outer membrane

    • This association is abolished in mdm31Δ mutants

    • This suggests Mdm31 helps link mtDNA to outer membrane complexes involved in mitochondrial segregation

  • Relationship to mitochondrial morphology:

    • The abnormal giant spherical mitochondria in mdm31Δ cells contain disorganized mtDNA

    • This suggests coordinated regulation of mitochondrial shape and genome organization

    • The defect may reflect failure of normal mitochondrial division processes that would normally distribute nucleoids

These findings highlight Mdm31's critical role in maintaining the organization and stability of the mitochondrial genome, likely through facilitating interactions between the inner membrane, outer membrane, and nucleoid structures.

What methodologies can be used to investigate the role of Mdm31 in phospholipid transport between mitochondrial membranes?

Investigating Mdm31's role in phospholipid transport between mitochondrial membranes requires sophisticated experimental approaches:

  • In vivo phospholipid labeling and analysis:

    • Metabolic labeling with [32P]Pi to track phospholipid synthesis and movement

    • Thin-layer chromatography (TLC) analysis of isolated mitochondrial fractions

    • Quantification of specific phospholipids like cardiolipin (CL) and phosphatidylethanolamine (PE)

    • Pulse-chase experiments to monitor phospholipid transport kinetics

  • Reconstituted in vitro systems:

    • Purification of Mdm31 and potential partners (Mdm32, Fmp30)

    • Preparation of liposomes with defined lipid composition

    • Fluorescently labeled lipid transfer assays between donor and acceptor vesicles

    • Analysis of lipid transfer rates with and without purified proteins

  • Biochemical interaction studies:

    • Crosslinking of Mdm31 to transported phospholipids

    • Mass spectrometry to identify bound lipids

    • Lipid binding assays using native or recombinant Mdm31

    • Competition assays to determine lipid specificity

  • Advanced microscopy techniques:

    • Fluorescently labeled phospholipid analogs to track movement in living cells

    • FRET-based approaches to monitor proximity of lipids to Mdm31

    • Super-resolution microscopy to visualize phospholipid domains in mitochondrial membranes

    • Correlative light and electron microscopy to link phospholipid distribution with membrane contact sites

  • Genetic manipulation with specific readouts:

    • Conditional expression systems (tet-MDM31) combined with phospholipid analysis

    • Domain-specific mutations in Mdm31 to identify regions involved in lipid transfer

    • Creation of chimeric proteins with known lipid transfer domains

    • Suppressor screens to identify compensatory mutations when Mdm31 function is compromised

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.