Recombinant Saccharomyces cerevisiae Mitochondrial distribution and morphology protein 32 (MDM32)

Shipped with Ice Packs
In Stock

Description

Biological Role in Mitochondrial Function

MDM32 is essential for maintaining mitochondrial morphology, DNA (mtDNA) stability, and membrane architecture:

  • Mitochondrial Morphogenesis:
    MDM32 collaborates with outer membrane proteins (Mmm1, Mdm10, Mdm12) to anchor mtDNA nucleoids to membrane complexes, ensuring proper mitochondrial shape and inheritance . Deletion results in giant spherical mitochondria with disorganized cristae and mtDNA instability .

  • mtDNA Nucleoid Organization:
    Cells lacking MDM32 exhibit diffuse, oversized mtDNA nucleoids due to disrupted interactions between matrix-localized DNA and Mmm1-containing outer membrane foci .

  • Genetic Interactions:
    Synthetic lethality occurs when MDM32 is deleted alongside MMM1, MDM10, or MDM12, highlighting its role in a shared mitochondrial integrity pathway .

Biochemical and Genetic Interactions

MDM32 operates within a network of mitochondrial proteins:

Interaction PartnerFunctional RoleExperimental Evidence
Mdm31Cooperates in cardiolipin (CL) biosynthesis; forms physical complexes with MDM32 Co-immunoprecipitation assays
Fmp30Essential for CL synthesis under low phosphatidylethanolamine (PE) conditions Synthetic genetic interactions
Mmm1/Mdm10Links inner and outer membrane systems for mtDNA segregation Synthetic lethality studies

Applications in Research

Recombinant MDM32 is utilized to:

  • Study mitochondrial membrane dynamics and cristae formation .

  • Investigate mtDNA inheritance defects linked to neurodegenerative diseases .

  • Analyze lipid metabolism pathways, particularly CL biosynthesis under stress conditions .

Key Research Findings

  • Mitochondrial DNA Instability: Δmdm32 mutants lose mtDNA nucleoid structure, leading to respiratory deficiency .

  • Membrane Structure Defects: Aberrant inner membrane organization in mutants disrupts mitochondrial motility and inheritance .

  • Role in Lipid Metabolism: MDM32, with Mdm31 and Fmp30, enables CL accumulation in UPS1-deficient yeast, critical for stress adaptation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
MDM32; SCY_5209; Mitochondrial distribution and morphology protein 32
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
71-622
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain YJM789) (Baker's yeast)
Target Names
MDM32
Target Protein Sequence
TKASNIETILLRKNNEREFKQSLLADAKNFQERFKINLKWILIKNNRPFSLNEISIIASW LILSQILWLILSTTTFISFYLFVINSVFSQEYIHEKKIYERLLKWLLKDHKCSNQDLEIT FSPEDKASMLVLSPDWESNSILIKRLNVRDEILDLDLKFHHINLNVSLKNWLLGRGLITN VSIYGIRGCLNLSNFINLVNSFQGDQKTENFLKTLNNVEITDSEILLKQSLSAQETPSLK FSIYNLSLPRLRLNHFISDILSAKTFSGSINNSLFNLFKRQQKLTAVIENNNKNRMASSK FDFTDNNQENYRTVTHQDDPNYVTTLRLNFININDLKFNGNGKFNWLKDGQVEILADIML TNSTSHLSSESKYAVVDLKVTCRDLKTTFPQEPPVLSTGDSIVSLDELKPIITFINSYEG MANPILKDFSENERLTNSIIWNSPNVSINRQRKSYPLTTKVTSNSTKEIIKFHNQPNTNA NEIVLRCKMVKNLSDLQLININQILDQITMELYVDLTKIVEDWEFKNKNDWMKQWGTTFA SQLLLFGFGAMV
Uniprot No.

Target Background

Function
MDM32 is involved in the organization of mitochondrial membranes and the overall structure of the mitochondria. It is also essential for mitochondrial distribution and mobility as well as the maintenance of mitochondrial DNA nucleoid structures.
Protein Families
MDM31/MDM32 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of MDM32 and where is it localized within yeast cells?

MDM32 (Mitochondrial Distribution and Morphology protein 32) is an inner mitochondrial membrane protein in Saccharomyces cerevisiae with two membrane-spanning regions, one located near the N-terminus and the other at the C-terminus . The middle region of the protein is exposed to the intermembrane space . The full-length protein spans amino acids 71-622 and has the UniProt ID Q12171 .

MDM32 contains multiple transmembrane domains that anchor it to the mitochondrial inner membrane, which is crucial for its function in maintaining mitochondrial morphology. The protein's topological arrangement allows it to interact with other mitochondrial membrane proteins while maintaining its structural integrity within the lipid bilayer. This specific localization is essential for its role in mitochondrial phospholipid metabolism and membrane organization.

What are the optimal storage and handling conditions for recombinant MDM32 protein?

Recombinant MDM32 protein requires careful handling to maintain its stability and activity. The lyophilized protein should be stored at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use to avoid repeated freeze-thaw cycles that can compromise protein integrity . For short-term storage, working aliquots can be maintained at 4°C for up to one week .

For reconstitution, the protein should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Addition of 5-50% glycerol (with 50% being the standard recommended concentration) to the reconstituted protein is advised for long-term storage at -20°C/-80°C . The protein is typically stored in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 .

Prior to opening, vials should be briefly centrifuged to ensure all material is at the bottom of the container. These handling procedures are critical for maintaining protein stability and functionality for experimental applications.

What is the primary biological function of MDM32 in yeast mitochondria?

MDM32 plays a crucial role in cardiolipin (CL) metabolism and mitochondrial membrane organization in Saccharomyces cerevisiae . Research has demonstrated that MDM32 functions cooperatively with other proteins, particularly Fmp30 and Mdm31, in facilitating cardiolipin accumulation through a UPS1-independent pathway . This function becomes especially critical when mitochondrial phosphatidylethanolamine (PE) levels are reduced.

The protein's importance is highlighted by the observation that deletion of MDM32 is synthetically lethal with the psd1Δ mutation, which affects phosphatidylserine decarboxylase responsible for PE synthesis within mitochondria . This synthetic lethality indicates that MDM32 becomes essential when the normal pathways of phospholipid metabolism are compromised.

MDM32's role in maintaining proper mitochondrial morphology is connected to its function in phospholipid metabolism, as the composition and organization of mitochondrial membranes directly influence mitochondrial shape, distribution, and function within the cell.

How does MDM32 interact with other mitochondrial proteins to maintain mitochondrial function?

MDM32 engages in physical interactions with multiple proteins in the mitochondrial inner membrane, most notably Fmp30 and Mdm31 . Immunoprecipitation experiments have confirmed these protein-protein interactions, with MDM32 showing a particularly strong association with Fmp30 . These three proteins (Fmp30, Mdm31, and MDM32) appear to function in the same pathway, as depletion of any one of them almost completely prevents cardiolipin synthesis under conditions of reduced mitochondrial PE and UPS1 deficiency .

The interaction network of MDM32 is specific, as control experiments showed that another inner membrane protein, Tim23, did not co-immunoprecipitate with either Mdm31 or MDM32 . The physical interaction between these proteins suggests they may form a functional complex that coordinates phospholipid metabolism and membrane organization.

The interaction between MDM32 and its partners appears to be regulated by cellular conditions, particularly the levels of phospholipids like PE in the mitochondrial membranes. These interactions represent a molecular mechanism by which cells adapt to changes in mitochondrial phospholipid composition.

Protein InteractionDetection MethodInteraction StrengthReference
MDM32-Fmp30Co-immunoprecipitation with anti-FLAG agarose beadsStrong
MDM32-Mdm31Co-immunoprecipitationPresent but weaker than MDM32-Fmp30
MDM32-Tim23Co-immunoprecipitationNot detected (negative control)

What are the recommended protocols for studying MDM32's role in cardiolipin metabolism?

To investigate MDM32's role in cardiolipin metabolism, researchers should consider a multi-faceted approach combining genetic manipulation with lipid analysis techniques. Based on previous research methodologies, the following protocol framework is recommended:

  • Genetic Manipulation: Utilize tetracycline-regulatable promoter systems (TET-off) to control MDM32 expression, which allows for conditional depletion of the protein rather than complete knockout, which may be lethal in certain genetic backgrounds . This approach was successfully employed to study the effect of MDM32 depletion on cardiolipin levels in various genetic backgrounds, including ups1Δ and ups2Δ mutations .

  • Phospholipid Analysis: Extract total lipids from isolated mitochondria and separate phospholipid classes by thin-layer chromatography. Quantify cardiolipin levels through phosphorus analysis or by using radiolabeled precursors . This enables precise measurement of how MDM32 manipulation affects cardiolipin accumulation.

  • Growth Phenotype Assessment: Correlate biochemical changes with physiological outcomes by monitoring cell growth under various conditions. Growth curve analysis of MDM32-depleted cells provides insights into the functional significance of observed changes in phospholipid composition .

  • Protein Interaction Studies: Employ co-immunoprecipitation techniques with epitope-tagged versions of MDM32 (such as FLAG-MDM32) to identify and confirm protein interaction partners . This approach has successfully identified interactions between MDM32 and other proteins involved in mitochondrial phospholipid metabolism.

This integrated approach allows for comprehensive characterization of MDM32's role in cardiolipin metabolism, connecting molecular mechanisms to cellular phenotypes.

What are the critical considerations when expressing and purifying recombinant MDM32 for functional studies?

Expressing and purifying functional recombinant MDM32 presents several challenges due to its membrane protein nature. Critical considerations include:

  • Expression System Selection: While E. coli has been successfully used for expressing recombinant MDM32 , membrane proteins often require specialized expression systems. For functional studies, consider using yeast expression systems that provide the appropriate cellular machinery for proper folding and post-translational modifications of a yeast mitochondrial protein.

  • Solubilization Strategy: As MDM32 is a membrane protein with multiple transmembrane domains, effective solubilization requires careful detergent selection. A systematic screening of detergents (e.g., DDM, LMNG, or GDN) is recommended to identify conditions that maintain the protein's native conformation and activity.

  • Purification Tags and Conditions: The use of His-tags has been demonstrated for MDM32 purification . Position the tag (N-terminal vs. C-terminal) to minimize interference with protein function. Consider including protease inhibitors throughout the purification process to prevent degradation.

  • Quality Control Assessment: Verify protein purity through SDS-PAGE (>90% purity is recommended) and assess protein folding through circular dichroism or limited proteolysis. For membrane proteins, reconstitution into liposomes or nanodiscs may be necessary to evaluate functional activity.

  • Storage Optimization: Store purified MDM32 with appropriate stabilizing agents such as glycerol (5-50%) and avoid repeated freeze-thaw cycles which can significantly reduce activity. Consider flash-freezing aliquots in liquid nitrogen for long-term storage.

These considerations should be systematically addressed to obtain functionally relevant recombinant MDM32 protein suitable for downstream applications such as structural studies, protein-protein interaction analyses, or in vitro functional assays.

How does the cooperative function between MDM32, Mdm31, and Fmp30 mechanistically contribute to cardiolipin synthesis under reduced PE conditions?

The cooperative function of MDM32, Mdm31, and Fmp30 in cardiolipin (CL) synthesis under reduced phosphatidylethanolamine (PE) conditions represents a complex adaptive mechanism that remains incompletely understood. Current evidence suggests several potential mechanistic models:

  • Alternative Phospholipid Transfer Complex: Under normal conditions, the Ups1-Mdm35 complex mediates phosphatidic acid transfer for CL synthesis. When PE levels are reduced and Ups1 is absent, the MDM32-Mdm31-Fmp30 complex may form an alternative transfer system for phospholipid precursors required for CL synthesis . This is supported by evidence that depletion of any of these three proteins almost completely prevents CL synthesis under these conditions .

  • Membrane Contact Site Formation: The physical interaction between MDM32, Mdm31, and Fmp30 may facilitate the formation of specialized membrane contact sites between the inner and outer mitochondrial membranes, providing spatial organization for lipid transfer enzymes involved in CL synthesis. This hypothesis is consistent with the observed localization of these proteins and their strong physical interactions .

  • Regulatory Influence on CL Synthase Activity: The protein complex might directly or indirectly regulate the activity of cardiolipin synthase (Crd1) or other enzymes in the CL synthesis pathway, compensating for altered phospholipid composition when PE levels are reduced.

To investigate these mechanistic possibilities, researchers should consider:

  • Using proximity labeling techniques (BioID or APEX) to identify additional components of this pathway

  • Employing cryo-electron microscopy to visualize membrane contact sites and protein complexes

  • Utilizing in vitro reconstitution systems with purified components to directly measure phospholipid transfer activities

  • Developing targeted lipidomic approaches to track phospholipid flux through this alternative pathway

Understanding this mechanism will provide important insights into mitochondrial membrane homeostasis and cellular adaptation to phospholipid imbalances.

What are the implications of MDM32 dysfunction for understanding mitochondrial diseases in higher eukaryotes?

While MDM32 has been primarily studied in Saccharomyces cerevisiae, its role in fundamental mitochondrial processes suggests potential relevance to mitochondrial dysfunction in higher eukaryotes. This connection warrants sophisticated research approaches:

  • Homology Analysis and Functional Conservation: Identify potential MDM32 homologs or functional analogs in higher eukaryotes through detailed bioinformatic analyses. Although direct sequence homology might be limited, proteins with similar domain architecture and localization could perform analogous functions in maintaining mitochondrial phospholipid homeostasis and morphology.

  • Disease Model Systems: Investigate whether disruption of potential MDM32 homologs or the pathways it participates in contributes to mitochondrial dysfunction in model systems relevant to human diseases. This could involve CRISPR-mediated gene editing in mammalian cells or model organisms like zebrafish or mice.

  • Cardiolipin Dysregulation in Disease: Given MDM32's role in cardiolipin metabolism, examine the connection to disorders characterized by cardiolipin abnormalities, such as Barth syndrome. Research should focus on whether pathways analogous to the MDM32-Mdm31-Fmp30 system might be therapeutic targets for diseases involving mitochondrial phospholipid imbalances.

  • Systems Biology Approach: Integrate transcriptomic, proteomic, and lipidomic data from mitochondrial disease models to identify disrupted networks that might involve functional analogs of the yeast MDM32 system. This could reveal unexpected connections between yeast mitochondrial biology and human disease mechanisms.

Methodologically, this research direction requires:

  • Comparative mitochondrial proteomics across species

  • Phospholipid trafficking assays in mammalian mitochondria

  • Development of small molecule modulators of cardiolipin metabolism

  • Patient-derived cell models to validate findings in a human disease context

These approaches could potentially translate fundamental insights from yeast MDM32 research into clinically relevant discoveries about mitochondrial disease mechanisms.

How can researchers address common challenges in generating MDM32 conditional mutants for functional studies?

Generating conditional mutants of MDM32 presents several technical challenges due to its essential nature in certain genetic backgrounds. Researchers can address these challenges using the following approaches:

  • Tetracycline-Regulatable Expression Systems: The tetracycline-regulatable promoter (TET-off) system has proven effective for conditional depletion of MDM32 . To optimize this system:

    • Carefully titrate doxycycline concentrations to achieve partial depletion when complete loss would be lethal

    • Verify depletion kinetics through western blot analysis at multiple time points

    • Consider genome integration of the TET-off cassette rather than plasmid-based expression for consistent regulation

  • Degron-Based Approaches: When rapid protein depletion is required:

    • Implement auxin-inducible degron (AID) tags that allow for rapid, post-translational depletion of MDM32

    • Optimize degron tag position to minimize interference with protein function while ensuring efficient degradation

    • Validate degron functionality by monitoring protein levels and mitochondrial phenotypes

  • Temperature-Sensitive Alleles: For temperature-dependent functional studies:

    • Generate libraries of randomly mutagenized MDM32 and screen for temperature-sensitive phenotypes

    • Characterize conditional mutants by assessing protein stability and mitochondrial function across temperature ranges

    • Combine with fluorescent tags to simultaneously monitor protein localization and mitochondrial morphology

  • Domain-Specific Mutants: To dissect specific functional domains:

    • Design targeted mutations in membrane-spanning regions versus intermembrane space domains

    • Use alanine-scanning mutagenesis of conserved residues

    • Complement mdm32Δ strains with mutant variants to assess functional rescue

Each approach should include appropriate controls and validation of mutant phenotypes through multiple assays, including growth tests, phospholipid analysis, and mitochondrial morphology assessment to ensure reliable interpretation of results.

What strategies can overcome challenges in analyzing MDM32's role in complex lipid metabolism pathways?

Analyzing MDM32's precise role in lipid metabolism pathways presents significant challenges due to the complexity of mitochondrial phospholipid metabolism and potential redundancy in these systems. Effective strategies include:

  • Metabolic Labeling with Stable Isotopes:

    • Employ 13C-labeled precursors to trace phospholipid synthesis pathways

    • Analyze incorporation patterns using LC-MS/MS to distinguish between multiple synthetic routes

    • Compare flux rates between wild-type and MDM32-depleted cells to identify rate-limiting steps

  • Synthetic Genetic Array Analysis:

    • Systematically combine MDM32 mutations with genome-wide gene deletions to identify functional interactions

    • Focus analysis on genes involved in phospholipid metabolism, mitochondrial dynamics, and membrane organization

    • Quantify genetic interactions to construct functional networks around MDM32

  • In Organello Reconstitution Systems:

    • Isolate mitochondria from MDM32-depleted cells and attempt to rescue cardiolipin synthesis with purified components

    • Systematically add back purified MDM32, Mdm31, and Fmp30 to determine minimal requirements

    • Monitor lipid transfer and synthesis activities using fluorescently labeled phospholipid precursors

  • Advanced Microscopy Techniques:

    • Apply super-resolution microscopy (STED or STORM) to visualize MDM32 distribution relative to sites of cardiolipin synthesis

    • Use FRET-based sensors to detect protein-protein interactions in live cells

    • Implement correlative light and electron microscopy to connect protein localization with membrane ultrastructure

  • Computational Modeling:

    • Develop mathematical models of mitochondrial phospholipid metabolism

    • Incorporate experimental data on reaction rates and protein levels

    • Simulate the effects of MDM32 depletion to generate testable predictions about pathway regulation

These integrated approaches can help overcome the technical challenges inherent in studying complex lipid metabolism pathways, providing a more comprehensive understanding of MDM32's specific contributions.

What emerging technologies could advance our understanding of MDM32's structure-function relationship?

Several cutting-edge technologies show promise for elucidating the structure-function relationship of MDM32:

  • Cryo-Electron Microscopy for Membrane Proteins:

    • Recent advances in cryo-EM have revolutionized structural biology of membrane proteins

    • Application to MDM32 could reveal its precise orientation in the membrane and interaction interfaces

    • Visualization of MDM32 in complex with Mdm31 and Fmp30 would provide unprecedented insights into their cooperative function

    • Technical considerations include optimizing detergent or nanodisc reconstitution methods specifically for this mitochondrial inner membrane protein

  • Integrative Structural Biology Approaches:

    • Combining multiple techniques (X-ray crystallography, NMR, SAXS, crosslinking mass spectrometry)

    • This hybrid approach can overcome limitations of individual methods for challenging membrane proteins

    • For MDM32, this could reveal dynamic structural changes associated with different functional states

  • In-Cell NMR and EPR Spectroscopy:

    • These techniques allow structural studies in native-like environments

    • Site-directed spin labeling coupled with EPR could map conformational changes during MDM32 function

    • Strategic incorporation of 19F-labeled amino acids would enable monitoring structural dynamics by NMR

  • Single-Molecule Techniques:

    • Single-molecule FRET to monitor conformational changes in real-time

    • Optical tweezers or atomic force microscopy to measure forces involved in protein-lipid interactions

    • These approaches could reveal transient intermediates in MDM32's functional cycle

  • AlphaFold and Advanced Computational Methods:

    • AI-based structure prediction tools like AlphaFold2 have dramatically improved membrane protein modeling

    • Molecular dynamics simulations in realistic membrane environments can predict lipid-protein interactions

    • Combining computational predictions with experimental validation could rapidly advance structural understanding

These emerging technologies, particularly when used in combination, have the potential to transform our understanding of how MDM32's structure enables its function in mitochondrial phospholipid metabolism and membrane organization.

How might systems biology approaches integrate MDM32 function into broader mitochondrial homeostasis networks?

Systems biology approaches offer powerful frameworks for contextualizing MDM32 within broader mitochondrial regulatory networks:

  • Multi-Omics Integration:

    • Combining transcriptomics, proteomics, lipidomics, and metabolomics data from MDM32 mutants

    • Construction of correlation networks to identify co-regulated processes

    • This integrative approach could reveal unexpected connections between MDM32-mediated lipid metabolism and other mitochondrial functions such as energy production, protein import, or quality control

  • Temporal Network Analysis:

    • Time-resolved studies following MDM32 depletion or overexpression

    • Identification of primary vs. secondary effects through temporal ordering of molecular changes

    • This approach could distinguish direct MDM32 functions from adaptive responses

  • Condition-Specific Network Modeling:

    • Mapping MDM32-dependent networks under various stressors (oxidative stress, altered carbon sources)

    • Comparative network analysis between normal and phospholipid-depleted conditions

    • This would provide insights into condition-specific roles of MDM32 in mitochondrial adaptation

  • Cross-Species Network Conservation:

    • Comparative analysis of mitochondrial lipid metabolism networks across evolutionary distance

    • Identification of conserved modules that may include functional analogs of MDM32 in higher eukaryotes

    • This evolutionary perspective could reveal fundamental principles of mitochondrial membrane organization

  • Perturbation-Based Network Inference:

    • Systematic genetic or chemical perturbations combined with high-dimensional phenotyping

    • Application of causal inference algorithms to reconstruct regulatory relationships

    • This approach could position MDM32 within hierarchical control systems for mitochondrial homeostasis

Implementation of these systems approaches requires:

  • Development of computational pipelines specifically designed for integrating heterogeneous mitochondrial data

  • Establishment of standardized experimental protocols for generating comparable datasets

  • Creation of mitochondria-specific network visualization tools to represent the unique topology of these organelles

These systems biology approaches will ultimately enable a comprehensive understanding of how MDM32 contributes to mitochondrial resilience and adaptation in changing cellular environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.